YOR231C-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR231C-A_S288C   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_AWRI1631   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_AWRI796   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_CBS7960   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_CLIB215   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_CLIB324   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_EC1118   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_EC9-8   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_FostersB   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_FostersO   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_JAY291   1   MCLSLLKRIFLIHFSIYIWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_Kyokai7   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_LalvinQA23   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_M22   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_PW5   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_T7   1   MCLSLLKRIFLIHFSIYTWKRSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_T73   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_UC5   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_VL3   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_Vin13   1   MCLSLLKRIFFDPFFNLHLETEP--PAPSPRMPNVSILSFKFA-YFQPFS   47
YOR231C-A_Y10   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_YJM269   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_YJM789   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
YOR231C-A_ZTW1   1   MCLSLLKRIFLIHFSIYTWKQSHRLLLLECLMSRSYLLNLHISNHFHPID   50
         

YOR231C-A_S288C   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_AWRI1631   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_AWRI796   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_CBS7960   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_CLIB215   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_CLIB324   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_EC1118   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_EC9-8   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_FostersB   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_FostersO   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_JAY291   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_Kyokai7   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_LalvinQA23   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_M22   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_PW5   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_T7   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_T73   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_UC5   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_VL3   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_Vin13   48   SN--------------   49
YOR231C-A_Y10   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_YJM269   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_YJM789   51   QHLVHCLSLCTIQKMI   66
YOR231C-A_ZTW1   51   QHLVHCLSLCTIQKMI   66
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOR231C-A_S288C from SGD:

YOR231C-A_S288C [source=SGD]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_AWRI1631 from AWRI:

YOR231C-A_AWRI1631 [source=AWRI]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_AWRI796 from AWRI:

YOR231C-A_AWRI796 [source=AWRI]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_CBS7960 from WashU:

YOR231C-A_CBS7960 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_CLIB215 from WashU:

YOR231C-A_CLIB215 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_CLIB324 from WashU:

YOR231C-A_CLIB324 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_EC1118 from Genoscope:

YOR231C-A_EC1118 [source=Genoscope]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_EC9-8 from ASinica:

YOR231C-A_EC9-8 [source=ASinica]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_FostersB from AWRI:

YOR231C-A_FostersB [source=AWRI]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_FostersO from AWRI:

YOR231C-A_FostersO [source=AWRI]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_JAY291 from Duke:

YOR231C-A_JAY291 [source=Duke]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9734  ..

       1  MCLSLLKRIF LIHFSIYIWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_Kyokai7 from NRIB:

YOR231C-A_Kyokai7 [source=NRIB]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_LalvinQA23 from AWRI:

YOR231C-A_LalvinQA23 [source=AWRI]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_M22 from WashU:

YOR231C-A_M22 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_PW5 from WashU:

YOR231C-A_PW5 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_T7 from WashU:

YOR231C-A_T7 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9953  ..

       1  MCLSLLKRIF LIHFSIYTWK RSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_T73 from WashU:

YOR231C-A_T73 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_UC5 from WashU:

YOR231C-A_UC5 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_VL3 from AWRI:

YOR231C-A_VL3 [source=AWRI]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_Vin13 from AWRI:

YOR231C-A_Vin13 [source=AWRI]  Length: 50  Sat Sep 23 23:23:01 2017  Type: P  Check: 6364  ..

       1  MCLSLLKRIF FDPFFNLHLE TEPPAPSPRM PNVSILSFKF AYFQPFSSN*


Protein Sequence for YOR231C-A_Y10 from WashU:

YOR231C-A_Y10 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_YJM269 from WashU:

YOR231C-A_YJM269 [source=WashU]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_YJM789 from Stanford:

YOR231C-A_YJM789 [source=Stanford]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*

Protein Sequence for YOR231C-A_ZTW1 from Zhejiang:

YOR231C-A_ZTW1 [source=Zhejiang]  Length: 67  Sat Sep 23 23:23:01 2017  Type: P  Check: 9932  ..

       1  MCLSLLKRIF LIHFSIYTWK QSHRLLLLEC LMSRSYLLNL HISNHFHPID

      51  QHLVHCLSLC TIQKMI*