MSB1/YOR188W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR188W_S288C   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_BY4741   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_BY4742   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_CBS7960   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_CEN.PK   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_D273-10B   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_DBVPG6044   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKHQNNEKNVPRSNGR   50
YOR188W_EC1118   1   MNDMAEPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_EC9-8   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_FL100   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_FY1679   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   
   --------------------------------------------------   
YOR188W_JAY291   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_JK9-3d   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_K11   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_Kyokai7   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_L1528   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_LalvinQA23   
   --------------------------------------------------   
YOR188W_PW5   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKHQNNEKNVPRSNGR   50
YOR188W_RM11-1a   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_RedStar   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_SEY6210   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_SK1   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKHQNNEKNVPRSNGR   50
YOR188W_T7   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_UC5   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_UWOPS05_217_3   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_VL3   
   --------------------------------------------------   
YOR188W_Vin13   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_W303   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_X2180-1A   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_Y55   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_YJM269   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_YJM339   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKHQNNEKNVPRSNGR   50
YOR188W_YJM789   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_YPH499   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_YPS128   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_YPS163   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_YS9   1   MNDMAKPLPTPPTAEIRKSRSNSPKKAQKTNLSPNKNQNNEKNVPRSNGR   50
YOR188W_ZTW1   1   MNDMAKPLPTPPTAEIRKSRSNSPIKAQKTNLSPNKNQNNEKNVPRSNGR   50
         

YOR188W_S288C   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_BY4741   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_BY4742   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_CBS7960   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_CEN.PK   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_D273-10B   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_DBVPG6044   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_EC1118   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_EC9-8   51   TKNEHNSMDDEEFEFFHRFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_FL100   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_FY1679   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   
   --------------------------------------------------   
YOR188W_JAY291   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_JK9-3d   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_K11   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_Kyokai7   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_L1528   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_LalvinQA23   
   --------------------------------------------------   
YOR188W_PW5   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_RM11-1a   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_RedStar   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_SEY6210   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_SK1   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_T7   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_UC5   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_UWOPS05_217_3   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_VL3   
   --------------------------------------------------   
YOR188W_Vin13   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_W303   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_X2180-1A   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_Y55   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_YJM269   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_YJM339   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_YJM789   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_YPH499   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_YPS128   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_YPS163   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_YS9   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
YOR188W_ZTW1   51   TKNEHNSMDDEEFEFFHQFSREKVKGVIHVITAELKEKGPDVEFLMIPFR   100
         

YOR188W_S288C   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_BY4741   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_BY4742   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_CBS7960   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_CEN.PK   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_D273-10B   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_DBVPG6044   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_EC1118   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_EC9-8   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_FL100   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_FY1679   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   
   --------------------------------------------------   
YOR188W_JAY291   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_JK9-3d   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_K11   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_Kyokai7   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_L1528   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_LalvinQA23   
   --------------------------------------------------   
YOR188W_PW5   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_RM11-1a   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_RedStar   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_SEY6210   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_SK1   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_T7   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_UC5   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_UWOPS05_217_3   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_VL3   
   --------------------------------------------------   
YOR188W_Vin13   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_W303   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_X2180-1A   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_Y55   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_YJM269   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_YJM339   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_YJM789   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_YPH499   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_YPS128   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_YPS163   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_YS9   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
YOR188W_ZTW1   101   PEQTNDKLLTLLNQLFPLGNGQPVNEKKQLRIVSKADVWTLFQCLKYIWC   150
         

YOR188W_S288C   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_BY4741   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_BY4742   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_CBS7960   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_CEN.PK   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_D273-10B   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_DBVPG6044   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_EC1118   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_EC9-8   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_FL100   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_FY1679   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   1   ---------------------------------MPQCLASPNHASIVYDF   17
YOR188W_JAY291   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_JK9-3d   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_K11   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_Kyokai7   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_L1528   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_LalvinQA23   
   --------------------------------------------------   
YOR188W_PW5   151   RLPNSEIIGWKSYLEFKFREKDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_RM11-1a   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_RedStar   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_SEY6210   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_SK1   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_T7   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_UC5   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPRCLASPNHASIVYDF   200
YOR188W_UWOPS05_217_3   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_VL3   
   --------------------------------------------------   
YOR188W_Vin13   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_W303   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_X2180-1A   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_Y55   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_YJM269   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_YJM339   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_YJM789   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_YPH499   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_YPS128   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_YPS163   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_YS9   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
YOR188W_ZTW1   151   RLPNSEIIGWKSYLEFKFREEDKKFPRKSFLEIMPQCLASPNHASIVYDF   200
         

YOR188W_S288C   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_BY4741   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_BY4742   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_CBS7960   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_CEN.PK   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_D273-10B   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_DBVPG6044   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_EC1118   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_EC9-8   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_FL100   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_FY1679   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   18   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   67
YOR188W_JAY291   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_JK9-3d   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_K11   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_Kyokai7   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_L1528   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_LalvinQA23   
   --------------------------------------------------   
YOR188W_PW5   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_RM11-1a   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_RedStar   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_SEY6210   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_SK1   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_T7   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_UC5   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_UWOPS05_217_3   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_VL3   
   --------------------------------------------------   
YOR188W_Vin13   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_W303   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_X2180-1A   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_Y55   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_YJM269   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_YJM339   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_YJM789   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_YPH499   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_YPS128   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_YPS163   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_YS9   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
YOR188W_ZTW1   201   FDLIISISSNSRVNKMSARKISKMCAIWAFSKQIPNSDIQDYDFESAAMK   250
         

YOR188W_S288C   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_BY4741   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_BY4742   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_CBS7960   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_CEN.PK   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_D273-10B   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_DBVPG6044   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_EC1118   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_EC9-8   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_FL100   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_FY1679   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   68   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   117
YOR188W_JAY291   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_JK9-3d   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_K11   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_Kyokai7   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_L1528   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_LalvinQA23   
   --------------------------------------------------   
YOR188W_PW5   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_RM11-1a   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_RedStar   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_SEY6210   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_SK1   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_T7   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_UC5   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_UWOPS05_217_3   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_VL3   
   --------------------------------------------------   
YOR188W_Vin13   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_W303   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_X2180-1A   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_Y55   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_YJM269   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_YJM339   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_YJM789   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_YPH499   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_YPS128   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_YPS163   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_YS9   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
YOR188W_ZTW1   251   SFAPNNSIQDGLDQWIPASDAMFHLLLAFLRSFVPQDLESAKLPRTLKSL   300
         

YOR188W_S288C   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_BY4741   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_BY4742   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_CBS7960   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_CEN.PK   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_D273-10B   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_DBVPG6044   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_EC1118   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_EC9-8   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_FL100   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_FY1679   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   118   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   167
YOR188W_JAY291   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_JK9-3d   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_K11   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_Kyokai7   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_L1528   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_LalvinQA23   
   --------------------------------------------------   
YOR188W_PW5   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_RM11-1a   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_RedStar   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_SEY6210   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_SK1   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_T7   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_UC5   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_UWOPS05_217_3   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_VL3   
   --------------------------------------------------   
YOR188W_Vin13   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_W303   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_X2180-1A   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_Y55   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_YJM269   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_YJM339   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_YJM789   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_YPH499   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_YPS128   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_YPS163   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_YS9   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
YOR188W_ZTW1   301   LFNNQYPPRKSTAYTSETILTIPLVTLKTDVFSRKPWQLLERCNDLLDFS   350
         

YOR188W_S288C   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_BY4741   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_BY4742   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_CBS7960   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_CEN.PK   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_D273-10B   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_DBVPG6044   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_EC1118   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_EC9-8   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_FL100   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_FY1679   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   168   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   217
YOR188W_JAY291   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_JK9-3d   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_K11   351   DHDAFEAREDYALLKSLFIKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_Kyokai7   351   DHDAFEAREDYALLKSLFIKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_L1528   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_LalvinQA23   
   --------------------------------------------------   
YOR188W_PW5   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_RM11-1a   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_RedStar   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_SEY6210   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_SK1   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_T7   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_UC5   351   DHDAFEAREDYALLKSLFIKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_UWOPS05_217_3   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_VL3   
   --------------------------------------------------   
YOR188W_Vin13   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_W303   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_X2180-1A   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_Y55   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_YJM269   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_YJM339   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_YJM789   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_YPH499   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_YPS128   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_YPS163   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_YS9   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
YOR188W_ZTW1   351   DHDAFEAREDYALLKSLFRKKNTVEGISRKMSQESRRLMKAMSTKHSTFQ   400
         

YOR188W_S288C   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_BY4741   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_BY4742   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_CBS7960   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_CEN.PK   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_D273-10B   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_DBVPG6044   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_EC1118   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_EC9-8   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_FL100   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_FY1679   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_FostersB   
   --------------------------------------------------   
YOR188W_FostersO   218   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   267
YOR188W_JAY291   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_JK9-3d   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_K11   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_Kyokai7   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_L1528   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_LalvinQA23   1   --------------------------MIILFGLGYRPFLSNKHPKRKKFL   24
YOR188W_PW5   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_RM11-1a   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_RedStar   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_SEY6210   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_SK1   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_T7   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_UC5   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_UWOPS05_217_3   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_VL3   1   --------------------------MIILFGLGYRPFLSNKHPKRKKFL   24
YOR188W_Vin13   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_W303   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_X2180-1A   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_Y55   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_YJM269   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_YJM339   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_YJM789   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_YPH499   401   PGWAPRECIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_YPS128   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_YPS163   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_YS9   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
YOR188W_ZTW1   401   PGWAPRKCIENISHLKECIEVKRLDIDDYFIWTWLSSLSFEQTSEKKKIF   450
         

YOR188W_S288C   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_BY4741   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_BY4742   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_CBS7960   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_CEN.PK   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_D273-10B   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_DBVPG6044   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_EC1118   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_EC9-8   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_FL100   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_FY1679   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_FostersB   1   ----------MDLKXWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   40
YOR188W_FostersO   268   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKNFCTVTNDRKGTT   317
YOR188W_JAY291   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_JK9-3d   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_K11   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_Kyokai7   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_L1528   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_LalvinQA23   25   EDLLYWNLNLMDLKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   74
YOR188W_PW5   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_RM11-1a   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_RedStar   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_SEY6210   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_SK1   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_T7   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_UC5   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_UWOPS05_217_3   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_VL3   25   EDLLYWNLNLMDLKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   74
YOR188W_Vin13   451   GRSIILEFEFDGFKKMGGFPRM----------------------------   472
YOR188W_W303   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_X2180-1A   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_Y55   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_YJM269   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_YJM339   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_YJM789   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_YPH499   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_YPS128   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_YPS163   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_YS9   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
YOR188W_ZTW1   451   GRSIILEFEFDGFKKWVVFQECDITLDYNKKGQLKKKTSAQSPTTEKELP   500
         

YOR188W_S288C   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_BY4741   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_BY4742   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_CBS7960   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_CEN.PK   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_D273-10B   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_DBVPG6044   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_EC1118   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_EC9-8   501   PDDFELEDPPLSKSPTLSQTYKKFQAGVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_FL100   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_FY1679   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_FostersB   41   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   90
YOR188W_FostersO   318   S-------------------------------------------------   318
YOR188W_JAY291   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_JK9-3d   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_K11   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_Kyokai7   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_L1528   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_LalvinQA23   75   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   124
YOR188W_PW5   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTIRRDSAPDNQGIYHTVI   550
YOR188W_RM11-1a   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_RedStar   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_SEY6210   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_SK1   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_T7   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_UC5   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_UWOPS05_217_3   501   PDDFELEDPPLSKSPTLSQTYKKFQAKVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_VL3   75   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   124
YOR188W_Vin13   
   --------------------------------------------------   
YOR188W_W303   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_X2180-1A   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_Y55   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_YJM269   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_YJM339   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_YJM789   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_YPH499   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_YPS128   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_YPS163   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_YS9   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
YOR188W_ZTW1   501   PDDFELEDPPLSKSPTLSQTYKKFQAEVPQQSTVRRDSAPDNQGIYHTVI   550
         

YOR188W_S288C   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_AWRI796   
   --------------------------------------------------   
YOR188W_BC187   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_BY4741   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_BY4742   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_CBS7960   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_CEN.PK   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_D273-10B   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_DBVPG6044   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_EC1118   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_EC9-8   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_FL100   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_FY1679   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_FostersB   91   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   140
YOR188W_FostersO   
   --------------------------------------------------   
YOR188W_JAY291   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_JK9-3d   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_K11   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_Kyokai7   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_L1528   551   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSGSNSSSSSFEEKSKDA   600
YOR188W_LalvinQA23   125   SKNALTKNKHNVNLHSFEHKISKWNPLNNLRKKSG