DCI1/YOR180C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR180C_S288C   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_AWRI1631   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFGYIALLLHKANDIDSVLF   50
YOR180C_AWRI796   
   --------------------------------------------------   
YOR180C_BC187   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFGYIALLLHKANDIDSVLF   50
YOR180C_BY4741   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_BY4742   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_CBS7960   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_CEN.PK   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_CLIB215   
   --------------------------------------------------   
YOR180C_CLIB324   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_D273-10B   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_DBVPG6044   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLC   50
YOR180C_EC1118   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_EC9-8   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_FL100   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_FY1679   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_FostersB   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_FostersO   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_JAY291   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_JK9-3d   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_K11   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_Kyokai7   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_L1528   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_LalvinQA23   
   --------------------------------------------------   
YOR180C_M22   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFGYIALLLHKANDIDSVLF   50
YOR180C_PW5   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLC   50
YOR180C_RM11-1a   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFGYIALLLHKANDIDSVLF   50
YOR180C_RedStar   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_SEY6210   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_SK1   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLC   50
YOR180C_T7   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_UC5   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_VL3   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFGYIALLLHKANDIDSVLF   50
YOR180C_Vin13   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_W303   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_X2180-1A   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_Y55   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_YJM269   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_YJM339   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_YJM789   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFGYIALLLHKANDIDSVLF   50
YOR180C_YPH499   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_YPS128   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_YPS163   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_YS9   1   MSSRVCYHINGPFFIIKLIDPKLLNSLTFEDFVYIALLLHKANDIDSVLF   50
YOR180C_ZTW1   1   MSSRVCYHINGPFFIIKLIDPKHLNSLTFEDFVYIALLLHKANDIDSVLF   50
         

YOR180C_S288C   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_AWRI1631   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_AWRI796   
   --------------------------------------------------   
YOR180C_BC187   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_BY4741   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_BY4742   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_CBS7960   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_CEN.PK   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_CLIB215   
   --------------------------------------------------   
YOR180C_CLIB324   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_D273-10B   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_DBVPG6044   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_EC1118   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_EC9-8   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_FL100   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_FY1679   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_FostersB   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTCEVEKVSKLVSAISSPNIFVAN   100
YOR180C_FostersO   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTXEVEKVSKLVSAISSPNIFVAN   100
YOR180C_JAY291   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_JK9-3d   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_K11   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_Kyokai7   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_L1528   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_LalvinQA23   
   --------------------------------------------------   
YOR180C_M22   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_PW5   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_RM11-1a   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_RedStar   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_SEY6210   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_SK1   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_T7   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_UC5   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_VL3   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_Vin13   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_W303   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_X2180-1A   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_Y55   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_YJM269   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_YJM339   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_YJM789   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_YPH499   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_YPS128   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_YPS163   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_YS9   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
YOR180C_ZTW1   51   TVLQSSGKYFSSGGKFSAVNKLNDGDVTSEVEKVSKLVSAISSPNIFVAN   100
         

YOR180C_S288C   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_AWRI1631   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_AWRI796   
   --------------------------------------------------   
YOR180C_BC187   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_BY4741   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_BY4742   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_CBS7960   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_CEN.PK   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_CLIB215   
   --------------------------------------------------   
YOR180C_CLIB324   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_D273-10B   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_DBVPG6044   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_EC1118   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_EC9-8   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_FL100   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_FY1679   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_FostersB   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_FostersO   101   AFAIHKKVLVCCLNGPAIGLSXSLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_JAY291   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_JK9-3d   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_K11   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_Kyokai7   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_L1528   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_LalvinQA23   
   --------------------------------------------------   
YOR180C_M22   101   AFAMHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_PW5   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_RM11-1a   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_RedStar   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_SEY6210   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_SK1   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_T7   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_UC5   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_VL3   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_Vin13   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_W303   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_X2180-1A   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_Y55   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_YJM269   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_YJM339   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_YJM789   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_YPH499   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_YPS128   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_YPS163   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_YS9   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
YOR180C_ZTW1   101   AFAIHKKVLVCCLNGPAIGLSASLVALCDIVYSQNDSVFLLFPFSNLGFV   150
         

YOR180C_S288C   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_AWRI1631   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_AWRI796   1   ---------------------MIFSTPVLFKELIGTIITKNYQLTNTETF   29
YOR180C_BC187   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_BY4741   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_BY4742   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_CBS7960   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_CEN.PK   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_CLIB215   1   ---------------------MIFSTPVLFKELIGTIITKNYQLTNTETF   29
YOR180C_CLIB324   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_D273-10B   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_DBVPG6044   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_EC1118   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_EC9-8   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_FL100   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_FY1679   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_FostersB   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_FostersO   151   AEVGTSVTLTQKLGINSANEHMIFITPVXFKELIGTIITKNYQLTNTETF   200
YOR180C_JAY291   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_JK9-3d   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_K11   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_Kyokai7   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_L1528   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_LalvinQA23   1   ---------------------MIFITPVXFKELIGTIITKNYQXTNTETX   29
YOR180C_M22   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_PW5   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_RM11-1a   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_RedStar   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_SEY6210   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_SK1   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_T7   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_UC5   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_VL3   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_Vin13   151   AEVGTSVTLTQKLGINSANEHMIFITPVXFKELIGTIITKNYQXTNTETX   200
YOR180C_W303   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_X2180-1A   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_Y55   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_YJM269   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_YJM339   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_YJM789   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_YPH499   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_YPS128   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_YPS163   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_YS9   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
YOR180C_ZTW1   151   AEVGTSVTLTQKLGINSANEHMIFSTPVLFKELIGTIITKNYQLTNTETF   200
         

YOR180C_S288C   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_AWRI1631   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_AWRI796   30   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   79
YOR180C_BC187   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_BY4741   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_BY4742   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_CBS7960   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_CEN.PK   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_CLIB215   30   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   79
YOR180C_CLIB324   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_D273-10B   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_DBVPG6044   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_EC1118   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_EC9-8   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_FL100   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_FY1679   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_FostersB   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_FostersO   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_JAY291   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_JK9-3d   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_K11   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_Kyokai7   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_L1528   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_LalvinQA23   30   NEKVLQDIKQNLEXLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   79
YOR180C_M22   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_PW5   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_RM11-1a   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_RedStar   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_SEY6210   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_SK1   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_T7   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_UC5   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_VL3   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_Vin13   201   NEKVLQDIKQNLEXLYPKKCTRYERIVTQ---------------------   229
YOR180C_W303   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_X2180-1A   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_Y55   201   NEKVLQDIKQNLEGLYPKSVIGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_YJM269   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_YJM339   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_YJM789   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_YPH499   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_YPS128   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_YPS163   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_YS9   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
YOR180C_ZTW1   201   NEKVLQDIKQNLEGLYPKSVLGMKELLHSEMKQKLIKAQAMETNGTLPFW   250
         

YOR180C_S288C   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_AWRI1631   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_AWRI796   80   ASGEPFKRFKQLQEGNRRHKL   100
YOR180C_BC187   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_BY4741   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_BY4742   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_CBS7960   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_CEN.PK   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_CLIB215   80   ASGEPFKRFKQLQEGNRRHKL   100
YOR180C_CLIB324   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_D273-10B   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_DBVPG6044   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_EC1118   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_EC9-8   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_FL100   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_FY1679   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_FostersB   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_FostersO   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_JAY291   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_JK9-3d   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_K11   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_Kyokai7   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_L1528   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_LalvinQA23   80   AIGEPFKRFKQLQEGNRRHKL   100
YOR180C_M22   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_PW5   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_RM11-1a   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_RedStar   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_SEY6210   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_SK1   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_T7   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_UC5   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_VL3   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_Vin13   
   ---------------------   
YOR180C_W303   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_X2180-1A   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_Y55   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_YJM269   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_YJM339   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_YJM789   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_YPH499   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_YPS128   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_YPS163   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_YS9   251   ASGEPFKRFKQLQEGNRRHKL   271
YOR180C_ZTW1   251   ASGEPFKRFKQLQEGNRRHKL   271
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOR180C_S288C from SGD:

YOR180C_S288C [source=SGD]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_AWRI1631 from AWRI:

YOR180C_AWRI1631 [source=AWRI]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7285  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFGYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_AWRI796 from AWRI:

YOR180C_AWRI796 [source=AWRI]  Length: 101  Sun Sep 24 04:11:19 2017  Type: P  Check: 313  ..

       1  MIFSTPVLFK ELIGTIITKN YQLTNTETFN EKVLQDIKQN LEGLYPKSVL

      51  GMKELLHSEM KQKLIKAQAM ETNGTLPFWA SGEPFKRFKQ LQEGNRRHKL

     101  *

Protein Sequence for YOR180C_BC187 from Stanford:

YOR180C_BC187 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7285  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFGYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_BY4741 from Stanford:

YOR180C_BY4741 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_BY4742 from Stanford:

YOR180C_BY4742 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_CBS7960 from WashU:

YOR180C_CBS7960 [source=WashU]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_CEN.PK from Stanford:

YOR180C_CEN.PK [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_CLIB215 from WashU:

YOR180C_CLIB215 [source=WashU]  Length: 101  Sun Sep 24 04:11:19 2017  Type: P  Check: 313  ..

       1  MIFSTPVLFK ELIGTIITKN YQLTNTETFN EKVLQDIKQN LEGLYPKSVL

      51  GMKELLHSEM KQKLIKAQAM ETNGTLPFWA SGEPFKRFKQ LQEGNRRHKL

     101  *

Protein Sequence for YOR180C_CLIB324 from WashU:

YOR180C_CLIB324 [source=WashU]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_D273-10B from Stanford:

YOR180C_D273-10B [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_DBVPG6044 from Stanford:

YOR180C_DBVPG6044 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7630  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLC

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_EC1118 from Genoscope:

YOR180C_EC1118 [source=Genoscope]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_EC9-8 from ASinica:

YOR180C_EC9-8 [source=ASinica]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_FL100 from Stanford:

YOR180C_FL100 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_FY1679 from Stanford:

YOR180C_FY1679 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_FostersB from AWRI:

YOR180C_FostersB [source=AWRI]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7428  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTCE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_FostersO from AWRI:

YOR180C_FostersO [source=AWRI]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 8130  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTXE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SXSLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFITPVXF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_JAY291 from Duke:

YOR180C_JAY291 [source=Duke]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_JK9-3d from Stanford:

YOR180C_JK9-3d [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_K11 from Stanford:

YOR180C_K11 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_Kyokai7 from NRIB:

YOR180C_Kyokai7 [source=NRIB]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_L1528 from Stanford:

YOR180C_L1528 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_LalvinQA23 from AWRI:

YOR180C_LalvinQA23 [source=AWRI]  Length: 101  Sun Sep 24 04:11:19 2017  Type: P  Check: 1658  ..

       1  MIFITPVXFK ELIGTIITKN YQXTNTETXN EKVLQDIKQN LEXLYPKSVL

      51  GMKELLHSEM KQKLIKAQAM ETNGTLPFWA IGEPFKRFKQ LQEGNRRHKL

     101  *

Protein Sequence for YOR180C_M22 from WashU:

YOR180C_M22 [source=WashU]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7473  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFGYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAMHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_PW5 from WashU:

YOR180C_PW5 [source=WashU]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7630  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLC

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_RM11-1a from Stanford:

YOR180C_RM11-1a [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7285  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFGYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_RedStar from Stanford:

YOR180C_RedStar [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_SEY6210 from Stanford:

YOR180C_SEY6210 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_SK1 from Stanford:

YOR180C_SK1 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7630  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLC

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_T7 from WashU:

YOR180C_T7 [source=WashU]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_UC5 from WashU:

YOR180C_UC5 [source=WashU]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_VL3 from AWRI:

YOR180C_VL3 [source=AWRI]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7285  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFGYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_Vin13 from AWRI:

YOR180C_Vin13 [source=AWRI]  Length: 230  Sun Sep 24 04:11:19 2017  Type: P  Check: 7678  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFITPVXF KELIGTIITK NYQXTNTETX

     201  NEKVLQDIKQ NLEXLYPKKC TRYERIVTQ*

Protein Sequence for YOR180C_W303 from Stanford:

YOR180C_W303 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_X2180-1A from Stanford:

YOR180C_X2180-1A [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_Y55 from Stanford:

YOR180C_Y55 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7630  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV IGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_YJM269 from WashU:

YOR180C_YJM269 [source=WashU]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_YJM339 from Stanford:

YOR180C_YJM339 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_YJM789 from Stanford:

YOR180C_YJM789 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7285  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFGYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_YPH499 from Stanford:

YOR180C_YPH499 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_YPS128 from Stanford:

YOR180C_YPS128 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_YPS163 from Stanford:

YOR180C_YPS163 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_YS9 from Stanford:

YOR180C_YS9 [source=Stanford]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7872  ..

       1  MSSRVCYHIN GPFFIIKLID PKLLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*

Protein Sequence for YOR180C_ZTW1 from Zhejiang:

YOR180C_ZTW1 [source=Zhejiang]  Length: 272  Sun Sep 24 04:11:19 2017  Type: P  Check: 7780  ..

       1  MSSRVCYHIN GPFFIIKLID PKHLNSLTFE DFVYIALLLH KANDIDSVLF

      51  TVLQSSGKYF SSGGKFSAVN KLNDGDVTSE VEKVSKLVSA ISSPNIFVAN

     101  AFAIHKKVLV CCLNGPAIGL SASLVALCDI VYSQNDSVFL LFPFSNLGFV

     151  AEVGTSVTLT QKLGINSANE HMIFSTPVLF KELIGTIITK NYQLTNTETF

     201  NEKVLQDIKQ NLEGLYPKSV LGMKELLHSE MKQKLIKAQA METNGTLPFW

     251  ASGEPFKRFK QLQEGNRRHK L*