YOR161W-B S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR161W-B_S288C   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_AWRI796   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_CBS7960   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_CLIB215   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_CLIB324   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_EC1118   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_EC9-8   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_FostersB   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_FostersO   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRXSVRPK   50
YOR161W-B_JAY291   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_Kyokai7   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMIIPQYINCFGKIRQSVRPK   50
YOR161W-B_LalvinQA23   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_PW5   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_T7   1   MNVKTKNTIPADQYLKDIYMIAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_T73   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_UC5   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMIIPQYINCFGKIRQSVRPK   50
YOR161W-B_VL3   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_Vin13   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_YJM789   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
YOR161W-B_ZTW1   1   MNVKTKNTIPADQYLKDMYMMAVPREATRLMTIPQYINCFGKIRQSVRPK   50
         

YOR161W-B_S288C   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_AWRI796   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_CBS7960   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_CLIB215   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_CLIB324   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_EC1118   51   TETTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_EC9-8   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_FostersB   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_FostersO   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_JAY291   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_Kyokai7   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_LalvinQA23   51   TEXXRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_PW5   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_T7   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_T73   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_UC5   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_VL3   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_Vin13   51   TEXTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_YJM789   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
YOR161W-B_ZTW1   51   TENTRAIMHTKTSRMAALVFSVPVFTPSYIPEPVLL   86
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOR161W-B_S288C from SGD:

YOR161W-B_S288C [source=SGD]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_AWRI796 from AWRI:

YOR161W-B_AWRI796 [source=AWRI]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_CBS7960 from WashU:

YOR161W-B_CBS7960 [source=WashU]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_CLIB215 from WashU:

YOR161W-B_CLIB215 [source=WashU]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_CLIB324 from WashU:

YOR161W-B_CLIB324 [source=WashU]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_EC1118 from Genoscope:

YOR161W-B_EC1118 [source=Genoscope]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3807  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TETTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_EC9-8 from ASinica:

YOR161W-B_EC9-8 [source=ASinica]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_FostersB from AWRI:

YOR161W-B_FostersB [source=AWRI]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_FostersO from AWRI:

YOR161W-B_FostersO [source=AWRI]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3804  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRXSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_JAY291 from Duke:

YOR161W-B_JAY291 [source=Duke]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_Kyokai7 from NRIB:

YOR161W-B_Kyokai7 [source=NRIB]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3137  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MIIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_LalvinQA23 from AWRI:

YOR161W-B_LalvinQA23 [source=AWRI]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 4235  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TEXXRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_PW5 from WashU:

YOR161W-B_PW5 [source=WashU]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_T7 from WashU:

YOR161W-B_T7 [source=WashU]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3333  ..

       1  MNVKTKNTIP ADQYLKDIYM IAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_T73 from WashU:

YOR161W-B_T73 [source=WashU]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_UC5 from WashU:

YOR161W-B_UC5 [source=WashU]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3137  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MIIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_VL3 from AWRI:

YOR161W-B_VL3 [source=AWRI]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_Vin13 from AWRI:

YOR161W-B_Vin13 [source=AWRI]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 4019  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TEXTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_YJM789 from Stanford:

YOR161W-B_YJM789 [source=Stanford]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*

Protein Sequence for YOR161W-B_ZTW1 from Zhejiang:

YOR161W-B_ZTW1 [source=Zhejiang]  Length: 87  Tue Sep 19 13:51:47 2017  Type: P  Check: 3489  ..

       1  MNVKTKNTIP ADQYLKDMYM MAVPREATRL MTIPQYINCF GKIRQSVRPK

      51  TENTRAIMHT KTSRMAALVF SVPVFTPSYI PEPVLL*