CYT1/YOR065W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR065W_S288C   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_AWRI1631   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_AWRI796   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_BC187   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_BY4741   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_BY4742   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_CBS7960   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_CEN.PK   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_CLIB215   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_D273-10B   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_DBVPG6044   1   MFSNLSKRWAQRTLSKSFYSTATDAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_EC1118   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_EC9-8   1   MLSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_FL100   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_FY1679   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_FostersB   1   MXSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKXVTAGVAAAGITAST   50
YOR065W_FostersO   1   MFXNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_JAY291   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_JK9-3d   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_K11   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_Kyokai7   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_L1528   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_LalvinQA23   
   --------------------------------------------------   
YOR065W_M22   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_PW5   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_RM11-1a   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_RedStar   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_SEY6210   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_SK1   1   MFSNLSKRWAQRTLSKSFYSTATDAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_T7   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_UC5   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_VL3   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_Vin13   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKXVTAGVAAAGITAST   50
YOR065W_W303   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_X2180-1A   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_Y10   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_Y55   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_YJM269   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_YJM339   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_YJM789   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_YPH499   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_YPS128   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_YPS163   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_YS9   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
YOR065W_ZTW1   1   MFSNLSKRWAQRTLSKSFYSTATGAASKSGKLTQKLVTAGVAAAGITAST   50
         

YOR065W_S288C   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_AWRI1631   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_AWRI796   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_BC187   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_BY4741   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_BY4742   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_CBS7960   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_CEN.PK   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_CLIB215   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_D273-10B   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_DBVPG6044   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_EC1118   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_EC9-8   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_FL100   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_FY1679   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_FostersB   51   LLYADSLTAEAMXAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_FostersO   51   LXYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_JAY291   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_JK9-3d   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_K11   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_Kyokai7   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_L1528   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_LalvinQA23   1   -----------------------MLGPTMGLLKHLIMHPLEEVTRFTVKF   27
YOR065W_M22   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_PW5   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_RM11-1a   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_RedStar   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_SEY6210   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_SK1   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_T7   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_UC5   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_VL3   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_Vin13   51   LLYADSLTAEAMXAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_W303   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_X2180-1A   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_Y10   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_Y55   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_YJM269   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_YJM339   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_YJM789   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_YPH499   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_YPS128   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_YPS163   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_YS9   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
YOR065W_ZTW1   51   LLYADSLTAEAMTAAEHGLHAPAYAWSHNGPFETFDHASIRRGYQVYREV   100
         

YOR065W_S288C   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_AWRI1631   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_AWRI796   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_BC187   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_BY4741   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_BY4742   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_CBS7960   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_CEN.PK   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_CLIB215   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_D273-10B   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_DBVPG6044   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_EC1118   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_EC9-8   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_FL100   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_FY1679   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_FostersB   101   CAACHSLDRVXWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_FostersO   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_JAY291   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_JK9-3d   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_K11   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_Kyokai7   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_L1528   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_LalvinQA23   28   VPPAILLTELPGELWLVFLIPTKRFVIWPKNLNTMTNLMNKVTLKRDQVN   77
YOR065W_M22   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_PW5   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_RM11-1a   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_RedStar   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_SEY6210   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_SK1   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_T7   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_UC5   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_VL3   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_Vin13   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_W303   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_X2180-1A   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_Y10   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_Y55   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_YJM269   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_YJM339   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_YJM789   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_YPH499   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_YPS128   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_YPS163   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_YS9   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
YOR065W_ZTW1   101   CAACHSLDRVAWRTLVGVSHTNEEVRNMAEEFEYDDEPDEQGNPKKRPGK   150
         

YOR065W_S288C   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_AWRI1631   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_AWRI796   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_BC187   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_BY4741   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_BY4742   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_CBS7960   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_CEN.PK   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_CLIB215   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_D273-10B   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_DBVPG6044   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_EC1118   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_EC9-8   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_FL100   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_FY1679   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_FostersB   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_FostersO   151   LSDYIPGPYPNEQAARAXNQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_JAY291   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_JK9-3d   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_K11   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_Kyokai7   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_L1528   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_LalvinQA23   78   CPITSLAHTQTNRLQELLTQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   127
YOR065W_M22   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_PW5   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_RM11-1a   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_RedStar   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_SEY6210   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_SK1   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_T7   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_UC5   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_VL3   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCXYIFSLLTGYPD   200
YOR065W_Vin13   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_W303   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_X2180-1A   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_Y10   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_Y55   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_YJM269   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_YJM339   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_YJM789   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_YPH499   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_YPS128   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_YPS163   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_YS9   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
YOR065W_ZTW1   151   LSDYIPGPYPNEQAARAANQGALPPDLSLIVKARHGGCDYIFSLLTGYPD   200
         

YOR065W_S288C   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_AWRI1631   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_AWRI796   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_BC187   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_BY4741   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_BY4742   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_CBS7960   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_CEN.PK   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_CLIB215   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_D273-10B   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_DBVPG6044   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_EC1118   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_EC9-8   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_FL100   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_FY1679   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_FostersB   201   EPPAGVALPLRF--------------------------------------   212
YOR065W_FostersO   201   EPPAGVALPXGSNYNPYFPGGSIAMARVFV--------------------   230
YOR065W_JAY291   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_JK9-3d   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_K11   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_Kyokai7   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_L1528   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_LalvinQA23   128   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   177
YOR065W_M22   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_PW5   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_RM11-1a   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_RedStar   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_SEY6210   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_SK1   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_T7   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_UC5   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_VL3   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_Vin13   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_W303   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_X2180-1A   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_Y10   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_Y55   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_YJM269   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_YJM339   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_YJM789   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_YPH499   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_YPS128   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_YPS163   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_YS9   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
YOR065W_ZTW1   201   EPPAGVALPPGSNYNPYFPGGSIAMARVLFDDMVEYEDGTPATTSQMAKD   250
         

YOR065W_S288C   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_AWRI1631   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_AWRI796   251   VTTFFKLVCRTRT-------------------------------------   263
YOR065W_BC187   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_BY4741   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_BY4742   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_CBS7960   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_CEN.PK   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_CLIB215   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_D273-10B   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_DBVPG6044   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_EC1118   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_EC9-8   251   VTTFLNWCAEPEHDERKRLGLKTVIVLSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_FL100   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_FY1679   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_FostersB   
   --------------------------------------------------   
YOR065W_FostersO   
   --------------------------------------------------   
YOR065W_JAY291   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_JK9-3d   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_K11   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_Kyokai7   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIK----   296
YOR065W_L1528   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_LalvinQA23   178   VTTFLNWCAEXEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   227
YOR065W_M22   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_PW5   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_RM11-1a   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_RedStar   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_SEY6210   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_SK1   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_T7   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_UC5   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_VL3   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_Vin13   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_W303   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_X2180-1A   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_Y10   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_Y55   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_YJM269   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_YJM339   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_YJM789   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_YPH499   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_YPS128   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_YPS163   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_YS9   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
YOR065W_ZTW1   251   VTTFLNWCAEPEHDERKRLGLKTVIILSSLYLLSIWVKKFKWAGIKTRKF   300
         

YOR065W_S288C   301   VFNPPKPRK-----   309
YOR065W_AWRI1631   301   VFNPPKPRK-----   309
YOR065W_AWRI796   
   --------------   
YOR065W_BC187   301   VFNPPKPRK-----   309
YOR065W_BY4741   301   VFNPPKPRK-----   309
YOR065W_BY4742   301   VFNPPKPRK-----   309
YOR065W_CBS7960   301   VFNPPKPRK-----   309
YOR065W_CEN.PK   301   VFNPPKPRK-----   309
YOR065W_CLIB215   301   VFNPPKPRK-----   309
YOR065W_D273-10B   301   VFNPPKPRK-----   309
YOR065W_DBVPG6044   301   VFNPPKPRK-----   309
YOR065W_EC1118   301   VFNPPKPRKSLTKK   314
YOR065W_EC9-8   301   VFNPPKPRK-----   309
YOR065W_FL100   301   VFNPPKPRK-----   309
YOR065W_FY1679   301   VFNPPKPRK-----   309
YOR065W_FostersB   
   --------------   
YOR065W_FostersO   
   --------------   
YOR065W_JAY291   301   VFNPPKPRK-----   309
YOR065W_JK9-3d   301   VFNPPKPRK-----   309
YOR065W_K11   301   VFNPPKPRK-----   309
YOR065W_Kyokai7   
   --------------   
YOR065W_L1528   301   VFNPPKPRK-----   309
YOR065W_LalvinQA23   228   VFNPPKPRKXLTKK   241
YOR065W_M22   301   VFNPPKPRK-----   309
YOR065W_PW5   301   VFNPPKPRK-----   309
YOR065W_RM11-1a   301   VFNPPKPRK-----   309
YOR065W_RedStar   301   VFNPPKPRK-----   309
YOR065W_SEY6210   301   VFNPPKPRK-----   309
YOR065W_SK1   301   VFNPPKPRK-----   309
YOR065W_T7   301   VFNPPKPRK-----   309
YOR065W_UC5   301   VFNPPKPRK-----   309
YOR065W_VL3   301   VFNPPKPRK-----   309
YOR065W_Vin13   301   VFNPPKPRKSLTKK   314
YOR065W_W303   301   VFNPPKPRK-----   309
YOR065W_X2180-1A   301   VFNPPKPRK-----   309
YOR065W_Y10   301   VFNPPKPRK-----   309
YOR065W_Y55   301   VFNPPKPRK-----   309
YOR065W_YJM269   301   VFNPPKPRQ-----   309
YOR065W_YJM339   301   VFNPPKPRK-----   309
YOR065W_YJM789   301   VFNPPKPRK-----   309
YOR065W_YPH499   301   VFNPPKPRK-----   309
YOR065W_YPS128   301   VFNPPKPRK-----   309
YOR065W_YPS163   301   VFNPPKPRK-----   309
YOR065W_YS9   301   VFNPPKPRK-----   309
YOR065W_ZTW1   301   VFNPPKPRK-----   309
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOR065W_S288C from SGD:

YOR065W_S288C [source=SGD]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_AWRI1631 from AWRI:

YOR065W_AWRI1631 [source=AWRI]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_AWRI796 from AWRI:

YOR065W_AWRI796 [source=AWRI]  Length: 264  Mon Sep 25 12:16:14 2017  Type: P  Check: 3193  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFFKLVCR TRT*

Protein Sequence for YOR065W_BC187 from Stanford:

YOR065W_BC187 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_BY4741 from Stanford:

YOR065W_BY4741 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_BY4742 from Stanford:

YOR065W_BY4742 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_CBS7960 from WashU:

YOR065W_CBS7960 [source=WashU]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_CEN.PK from Stanford:

YOR065W_CEN.PK [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_CLIB215 from WashU:

YOR065W_CLIB215 [source=WashU]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_D273-10B from Stanford:

YOR065W_D273-10B [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_DBVPG6044 from Stanford:

YOR065W_DBVPG6044 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3902  ..

       1  MFSNLSKRWA QRTLSKSFYS TATDAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_EC1118 from Genoscope:

YOR065W_EC1118 [source=Genoscope]  Length: 315  Mon Sep 25 12:16:14 2017  Type: P  Check: 4778  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRKS LTKK*

Protein Sequence for YOR065W_EC9-8 from ASinica:

YOR065W_EC9-8 [source=ASinica]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 4610  ..

       1  MLSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIVLSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_FL100 from Stanford:

YOR065W_FL100 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_FY1679 from Stanford:

YOR065W_FY1679 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_FostersB from AWRI:

YOR065W_FostersB [source=AWRI]  Length: 213  Mon Sep 25 12:16:14 2017  Type: P  Check: 4817  ..

       1  MXSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKXVTAG VAAAGITAST

      51  LLYADSLTAE AMXAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV XWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPL RF*

Protein Sequence for YOR065W_FostersO from AWRI:

YOR065W_FostersO [source=AWRI]  Length: 231  Mon Sep 25 12:16:14 2017  Type: P  Check: 5218  ..

       1  MFXNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LXYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAXNQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPX GSNYNPYFPG GSIAMARVFV *

Protein Sequence for YOR065W_JAY291 from Duke:

YOR065W_JAY291 [source=Duke]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_JK9-3d from Stanford:

YOR065W_JK9-3d [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_K11 from Stanford:

YOR065W_K11 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_Kyokai7 from NRIB:

YOR065W_Kyokai7 [source=NRIB]  Length: 296  Mon Sep 25 12:16:14 2017  Type: P  Check: 4639  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIK


Protein Sequence for YOR065W_L1528 from Stanford:

YOR065W_L1528 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_LalvinQA23 from AWRI:

YOR065W_LalvinQA23 [source=AWRI]  Length: 242  Mon Sep 25 12:16:14 2017  Type: P  Check: 5588  ..

       1  MLGPTMGLLK HLIMHPLEEV TRFTVKFVPP AILLTELPGE LWLVFLIPTK

      51  RFVIWPKNLN TMTNLMNKVT LKRDQVNCPI TSLAHTQTNR LQELLTQGAL

     101  PPDLSLIVKA RHGGCDYIFS LLTGYPDEPP AGVALPPGSN YNPYFPGGSI

     151  AMARVLFDDM VEYEDGTPAT TSQMAKDVTT FLNWCAEXEH DERKRLGLKT

     201  VIILSSLYLL SIWVKKFKWA GIKTRKFVFN PPKPRKXLTK K*


Protein Sequence for YOR065W_M22 from WashU:

YOR065W_M22 [source=WashU]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_PW5 from WashU:

YOR065W_PW5 [source=WashU]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_RM11-1a from Stanford:

YOR065W_RM11-1a [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_RedStar from Stanford:

YOR065W_RedStar [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_SEY6210 from Stanford:

YOR065W_SEY6210 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_SK1 from Stanford:

YOR065W_SK1 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3902  ..

       1  MFSNLSKRWA QRTLSKSFYS TATDAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_T7 from WashU:

YOR065W_T7 [source=WashU]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_UC5 from WashU:

YOR065W_UC5 [source=WashU]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_VL3 from AWRI:

YOR065W_VL3 [source=AWRI]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 4334  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCXY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_Vin13 from AWRI:

YOR065W_Vin13 [source=AWRI]  Length: 315  Mon Sep 25 12:16:14 2017  Type: P  Check: 5234  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKXVTAG VAAAGITAST

      51  LLYADSLTAE AMXAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRKS LTKK*

Protein Sequence for YOR065W_W303 from Stanford:

YOR065W_W303 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_X2180-1A from Stanford:

YOR065W_X2180-1A [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_Y10 from WashU:

YOR065W_Y10 [source=WashU]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_Y55 from Stanford:

YOR065W_Y55 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_YJM269 from WashU:

YOR065W_YJM269 [source=WashU]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 4118  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRQ*

Protein Sequence for YOR065W_YJM339 from Stanford:

YOR065W_YJM339 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_YJM789 from Stanford:

YOR065W_YJM789 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_YPH499 from Stanford:

YOR065W_YPH499 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_YPS128 from Stanford:

YOR065W_YPS128 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_YPS163 from Stanford:

YOR065W_YPS163 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_YS9 from Stanford:

YOR065W_YS9 [source=Stanford]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*

Protein Sequence for YOR065W_ZTW1 from Zhejiang:

YOR065W_ZTW1 [source=Zhejiang]  Length: 310  Mon Sep 25 12:16:14 2017  Type: P  Check: 3974  ..

       1  MFSNLSKRWA QRTLSKSFYS TATGAASKSG KLTQKLVTAG VAAAGITAST

      51  LLYADSLTAE AMTAAEHGLH APAYAWSHNG PFETFDHASI RRGYQVYREV

     101  CAACHSLDRV AWRTLVGVSH TNEEVRNMAE EFEYDDEPDE QGNPKKRPGK

     151  LSDYIPGPYP NEQAARAANQ GALPPDLSLI VKARHGGCDY IFSLLTGYPD

     201  EPPAGVALPP GSNYNPYFPG GSIAMARVLF DDMVEYEDGT PATTSQMAKD

     251  VTTFLNWCAE PEHDERKRLG LKTVIILSSL YLLSIWVKKF KWAGIKTRKF

     301  VFNPPKPRK*