YOR011W-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOR011W-A_S288C   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWC   50
YOR011W-A_AWRI1631   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWC   50
YOR011W-A_AWRI796   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_CBS7960   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_CLIB215   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWC   50
YOR011W-A_CLIB324   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_EC1118   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_EC9-8   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_FostersB   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKNRKNWTFQYWC   50
YOR011W-A_FostersO   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKXRKNWTFQYWC   50
YOR011W-A_JAY291   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_Kyokai7   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKNRKNWTFQYWC   50
YOR011W-A_LalvinQA23   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_PW5   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWC   50
YOR011W-A_T7   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWC   50
YOR011W-A_UC5   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKNRKNWTFQYWC   50
YOR011W-A_VL3   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_Vin13   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKSWTFQYWC   50
YOR011W-A_Y10   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWC   50
YOR011W-A_YJM269   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKNWTFQYWC   50
YOR011W-A_YJM789   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKSRKN-------   43
YOR011W-A_ZTW1   1   MAKSVFNFFHFEILEYLNRFVYHSQYFLPYYCSLEVLGKNRKNWTFQYWC   50
         

YOR011W-A_S288C   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_AWRI1631   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_AWRI796   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_CBS7960   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_CLIB215   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_CLIB324   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_EC1118   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_EC9-8   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_FostersB   51   LYITTDKKIIKKKXFYHR-------   68
YOR011W-A_FostersO   51   LYITTDKKIIKKKRFLSPIVSSLEN   75
YOR011W-A_JAY291   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_Kyokai7   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_LalvinQA23   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_PW5   51   LYITTDKKIIKKKEFYHR-------   68
YOR011W-A_T7   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_UC5   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_VL3   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_Vin13   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_Y10   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_YJM269   51   LYITTDKKIIKKKDFYHR-------   68
YOR011W-A_YJM789   
   -------------------------   
YOR011W-A_ZTW1   51   LYITTDKKIIKKKDFYHR-------   68
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOR011W-A_S288C from SGD:

YOR011W-A_S288C [source=SGD]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5571  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_AWRI1631 from AWRI:

YOR011W-A_AWRI1631 [source=AWRI]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5571  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_AWRI796 from AWRI:

YOR011W-A_AWRI796 [source=AWRI]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_CBS7960 from WashU:

YOR011W-A_CBS7960 [source=WashU]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_CLIB215 from WashU:

YOR011W-A_CLIB215 [source=WashU]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5571  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_CLIB324 from WashU:

YOR011W-A_CLIB324 [source=WashU]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_EC1118 from Genoscope:

YOR011W-A_EC1118 [source=Genoscope]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_EC9-8 from ASinica:

YOR011W-A_EC9-8 [source=ASinica]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_FostersB from AWRI:

YOR011W-A_FostersB [source=AWRI]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5511  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKN RKNWTFQYWC

      51  LYITTDKKII KKKXFYHR*

Protein Sequence for YOR011W-A_FostersO from AWRI:

YOR011W-A_FostersO [source=AWRI]  Length: 76  Fri Sep 22 02:56:07 2017  Type: P  Check: 4328  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKX RKNWTFQYWC

      51  LYITTDKKII KKKRFLSPIV SSLEN*

Protein Sequence for YOR011W-A_JAY291 from Duke:

YOR011W-A_JAY291 [source=Duke]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_Kyokai7 from NRIB:

YOR011W-A_Kyokai7 [source=NRIB]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5371  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKN RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_LalvinQA23 from AWRI:

YOR011W-A_LalvinQA23 [source=AWRI]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_PW5 from WashU:

YOR011W-A_PW5 [source=WashU]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5578  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKNWTFQYWC

      51  LYITTDKKII KKKEFYHR*

Protein Sequence for YOR011W-A_T7 from WashU:

YOR011W-A_T7 [source=WashU]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5571  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_UC5 from WashU:

YOR011W-A_UC5 [source=WashU]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5371  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKN RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_VL3 from AWRI:

YOR011W-A_VL3 [source=AWRI]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_Vin13 from AWRI:

YOR011W-A_Vin13 [source=AWRI]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5786  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKSWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_Y10 from WashU:

YOR011W-A_Y10 [source=WashU]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5571  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_YJM269 from WashU:

YOR011W-A_YJM269 [source=WashU]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5571  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*

Protein Sequence for YOR011W-A_YJM789 from Stanford:

YOR011W-A_YJM789 [source=Stanford]  Length: 44  Fri Sep 22 02:56:07 2017  Type: P  Check: 5759  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKS RKN*


Protein Sequence for YOR011W-A_ZTW1 from Zhejiang:

YOR011W-A_ZTW1 [source=Zhejiang]  Length: 69  Fri Sep 22 02:56:07 2017  Type: P  Check: 5371  ..

       1  MAKSVFNFFH FEILEYLNRF VYHSQYFLPY YCSLEVLGKN RKNWTFQYWC

      51  LYITTDKKII KKKDFYHR*