YOL131W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOL131W_S288C   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_AWRI1631   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_AWRI796   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_BC187   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEVK   50
YOL131W_BY4741   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_BY4742   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_CBS7960   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_CEN.PK   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_CLIB215   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_CLIB324   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_D273-10B   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_DBVPG6044   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_EC1118   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_EC9-8   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEVK   50
YOL131W_FL100   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_FY1679   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_FostersB   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_FostersO   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEVK   50
YOL131W_JAY291   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_JK9-3d   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_K11   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPGIK   50
YOL131W_Kyokai7   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPGIK   50
YOL131W_L1528   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_LalvinQA23   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_M22   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_PW5   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_RM11-1a   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_RedStar   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEVK   50
YOL131W_SEY6210   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_SK1   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_T7   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEVK   50
YOL131W_T73   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_UWOPS05_217_3   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_VL3   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_Vin13   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_W303   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_X2180-1A   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_Y10   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_Y55   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_YJM269   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_YJM339   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_YJM789   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_YPH499   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_YPS128   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEVK   50
YOL131W_YPS163   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEVK   50
YOL131W_YS9   1   MNTDKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEIK   50
YOL131W_ZTW1   1   MNTNKIAQDEVQDKVLQRAELAHSVWNLRFNLSKVAKRIRMETKVFPEVK   50
         

YOL131W_S288C   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_AWRI1631   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_AWRI796   51   INDAQSQLERSRCRIFSPDLEEKHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_BC187   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_BY4741   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_BY4742   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_CBS7960   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_CEN.PK   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_CLIB215   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_CLIB324   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_D273-10B   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_DBVPG6044   51   INDAQSQLKRSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEVE   100
YOL131W_EC1118   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_EC9-8   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_FL100   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_FY1679   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_FostersB   51   INDAQSQXERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_FostersO   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_JAY291   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_JK9-3d   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_K11   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_Kyokai7   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_L1528   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_LalvinQA23   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_M22   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_PW5   51   INDAQSQLKRSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_RM11-1a   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_RedStar   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_SEY6210   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_SK1   51   INDAQSQLKRSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEVE   100
YOL131W_T7   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_T73   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_UWOPS05_217_3   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_VL3   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_Vin13   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_W303   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_X2180-1A   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_Y10   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_Y55   51   INDAQSQLKRSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEVE   100
YOL131W_YJM269   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_YJM339   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_YJM789   51   INDAQSQLERSRCRIFNPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_YPH499   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_YPS128   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_YPS163   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_YS9   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
YOL131W_ZTW1   51   INDAQSQLERSRCRIFSPDLEEEHVPLIQGFKCLDSPPPVPPSSSQGEDE   100
         

YOL131W_S288C   101   ENTVDSQY   108
YOL131W_AWRI1631   101   ENTVDSQY   108
YOL131W_AWRI796   101   ENTVDSQY   108
YOL131W_BC187   101   ENTVDSQY   108
YOL131W_BY4741   101   ENTVDSQY   108
YOL131W_BY4742   101   ENTVDSQY   108
YOL131W_CBS7960   101   ENTVDSQY   108
YOL131W_CEN.PK   101   ENTVDSQY   108
YOL131W_CLIB215   101   ENTVDSQY   108
YOL131W_CLIB324   101   ENTVDSQY   108
YOL131W_D273-10B   101   ENTVDSQY   108
YOL131W_DBVPG6044   101   ENTVDSQY   108
YOL131W_EC1118   101   ENTVDSQY   108
YOL131W_EC9-8   101   ENTVDSQY   108
YOL131W_FL100   101   ENTVDSQY   108
YOL131W_FY1679   101   ENTVDSQY   108
YOL131W_FostersB   101   ENTVDSQY   108
YOL131W_FostersO   101   ENTVDSQY   108
YOL131W_JAY291   101   ENTVDSQY   108
YOL131W_JK9-3d   101   ENTVDSQY   108
YOL131W_K11   101   ENTIDSQY   108
YOL131W_Kyokai7   101   ENTIDSQY   108
YOL131W_L1528   101   ENTVDSQY   108
YOL131W_LalvinQA23   101   ENTVDSQY   108
YOL131W_M22   101   ENTVDSQY   108
YOL131W_PW5   101   ENTVDSQY   108
YOL131W_RM11-1a   101   ENTVDSQY   108
YOL131W_RedStar   101   ENTVDSQY   108
YOL131W_SEY6210   101   ENTVDSQY   108
YOL131W_SK1   101   ENTVDSQY   108
YOL131W_T7   101   ENTVDSQY   108
YOL131W_T73   101   ENTVDSQY   108
YOL131W_UWOPS05_217_3   101   ENTVDSQY   108
YOL131W_VL3   101   ENTVDSQY   108
YOL131W_Vin13   101   ENTVDSQY   108
YOL131W_W303   101   ENTVDSQY   108
YOL131W_X2180-1A   101   ENTVDSQY   108
YOL131W_Y10   101   ENTVDSQY   108
YOL131W_Y55   101   ENTVDSQY   108
YOL131W_YJM269   101   ENTVDSQY   108
YOL131W_YJM339   101   ENTVDSQY   108
YOL131W_YJM789   101   ENTVDSQY   108
YOL131W_YPH499   101   ENTVDSQY   108
YOL131W_YPS128   101   ENTVDSQY   108
YOL131W_YPS163   101   ENTVDSQY   108
YOL131W_YS9   101   ENTVDSQY   108
YOL131W_ZTW1   101   ENTVDSQY   108
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YOL131W_S288C from SGD:

YOL131W_S288C [source=SGD]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_AWRI1631 from AWRI:

YOL131W_AWRI1631 [source=AWRI]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_AWRI796 from AWRI:

YOL131W_AWRI796 [source=AWRI]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 920  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEKHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_BC187 from Stanford:

YOL131W_BC187 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1501  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEVK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_BY4741 from Stanford:

YOL131W_BY4741 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_BY4742 from Stanford:

YOL131W_BY4742 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_CBS7960 from WashU:

YOL131W_CBS7960 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_CEN.PK from Stanford:

YOL131W_CEN.PK [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_CLIB215 from WashU:

YOL131W_CLIB215 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_CLIB324 from WashU:

YOL131W_CLIB324 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_D273-10B from Stanford:

YOL131W_D273-10B [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_DBVPG6044 from Stanford:

YOL131W_DBVPG6044 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1632  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLKR SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEVE

     101  ENTVDSQY*

Protein Sequence for YOL131W_EC1118 from Genoscope:

YOL131W_EC1118 [source=Genoscope]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_EC9-8 from ASinica:

YOL131W_EC9-8 [source=ASinica]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1501  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEVK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_FL100 from Stanford:

YOL131W_FL100 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_FY1679 from Stanford:

YOL131W_FY1679 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_FostersB from AWRI:

YOL131W_FostersB [source=AWRI]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 836  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQXER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_FostersO from AWRI:

YOL131W_FostersO [source=AWRI]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1501  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEVK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_JAY291 from Duke:

YOL131W_JAY291 [source=Duke]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_JK9-3d from Stanford:

YOL131W_JK9-3d [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_K11 from Stanford:

YOL131W_K11 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 349  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPGIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTIDSQY*

Protein Sequence for YOL131W_Kyokai7 from NRIB:

YOL131W_Kyokai7 [source=NRIB]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 349  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPGIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTIDSQY*

Protein Sequence for YOL131W_L1528 from Stanford:

YOL131W_L1528 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_LalvinQA23 from AWRI:

YOL131W_LalvinQA23 [source=AWRI]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_M22 from WashU:

YOL131W_M22 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_PW5 from WashU:

YOL131W_PW5 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 876  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLKR SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_RM11-1a from Stanford:

YOL131W_RM11-1a [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_RedStar from Stanford:

YOL131W_RedStar [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1501  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEVK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_SEY6210 from Stanford:

YOL131W_SEY6210 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_SK1 from Stanford:

YOL131W_SK1 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1632  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLKR SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEVE

     101  ENTVDSQY*

Protein Sequence for YOL131W_T7 from WashU:

YOL131W_T7 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1501  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEVK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_T73 from WashU:

YOL131W_T73 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_UWOPS05_217_3 from Stanford:

YOL131W_UWOPS05_217_3 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_VL3 from AWRI:

YOL131W_VL3 [source=AWRI]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_Vin13 from AWRI:

YOL131W_Vin13 [source=AWRI]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_W303 from Stanford:

YOL131W_W303 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_X2180-1A from Stanford:

YOL131W_X2180-1A [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_Y10 from WashU:

YOL131W_Y10 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_Y55 from Stanford:

YOL131W_Y55 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1632  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLKR SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEVE

     101  ENTVDSQY*

Protein Sequence for YOL131W_YJM269 from WashU:

YOL131W_YJM269 [source=WashU]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_YJM339 from Stanford:

YOL131W_YJM339 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_YJM789 from Stanford:

YOL131W_YJM789 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 774  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFNPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_YPH499 from Stanford:

YOL131W_YPH499 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 864  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_YPS128 from Stanford:

YOL131W_YPS128 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1501  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEVK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_YPS163 from Stanford:

YOL131W_YPS163 [source=Stanford]  Length: 109  Mon Jan 22 04:16:36 2018  Type: P  Check: 1501  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEVK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_YS9 from Stanford:

YOL131W_YS9 [source=Stanford]  Length: 109  Mon Jan 22 04:16:37 2018  Type: P  Check: 824  ..

       1  MNTDKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEIK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*

Protein Sequence for YOL131W_ZTW1 from Zhejiang:

YOL131W_ZTW1 [source=Zhejiang]  Length: 109  Mon Jan 22 04:16:37 2018  Type: P  Check: 1501  ..

       1  MNTNKIAQDE VQDKVLQRAE LAHSVWNLRF NLSKVAKRIR METKVFPEVK

      51  INDAQSQLER SRCRIFSPDL EEEHVPLIQG FKCLDSPPPV PPSSSQGEDE

     101  ENTVDSQY*