SIN3/YOL004W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YOL004W_S288C   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_AWRI796   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_BC187   1   MSQVWHKSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_BY4741   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_BY4742   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_CEN.PK   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPTLQGNKPGFVQQQQRITL   50
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   
   --------------------------------------------------   
YOL004W_D273-10B   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_DBVPG6044   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_EC1118   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPSFVQQQQRITL   50
YOL004W_EC9-8   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_FL100   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_FY1679   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_FostersB   
   --------------------------------------------------   
YOL004W_FostersO   
   --------------------------------------------------   
YOL004W_JAY291   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_JK9-3d   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPTLQGNKPGFVQQQQRITL   50
YOL004W_K11   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPTLQGNKPGFVQQQQRITL   50
YOL004W_Kyokai7   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPTLQGNKPGFVQQQQRITL   50
YOL004W_L1528   1   MSQVWHKSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_LalvinQA23   
   --------------------------------------------------   
YOL004W_PW5   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_RM11-1a   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_RedStar   1   MSQVWHKSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_SEY6210   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_SK1   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPTLQGNKPGFVQQQQRITL   50
YOL004W_T7   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_UC5   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPTLQGNKPGFVQQQQRITL   50
YOL004W_UWOPS05_217_3   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_VL3   
   --------------------------------------------------   
YOL004W_Vin13   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_W303   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_X2180-1A   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_Y55   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_YJM269   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_YJM339   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_YJM789   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_YPH499   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPTLQGNKPGFVQQQQRITL   50
YOL004W_YPS128   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_YPS163   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_YS9   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPSLQGNKPGFVQQQQRITL   50
YOL004W_ZTW1   1   MSQVWHNSNSQSNDVATSNDATGSNERNEKEPTLQGNKPGFVQQQQRITL   50
         

YOL004W_S288C   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_AWRI796   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_BC187   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_BY4741   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_BY4742   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_CEN.PK   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   1   ---------------------------------------MPSIATDSALK   11
YOL004W_D273-10B   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_DBVPG6044   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_EC1118   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_EC9-8   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_FL100   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_FY1679   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_FostersB   
   --------------------------------------------------   
YOL004W_FostersO   
   --------------------------------------------------   
YOL004W_JAY291   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_JK9-3d   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_K11   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_Kyokai7   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_L1528   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_LalvinQA23   
   --------------------------------------------------   
YOL004W_PW5   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_RM11-1a   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_RedStar   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_SEY6210   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_SK1   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_T7   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_UC5   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_UWOPS05_217_3   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_VL3   
   --------------------------------------------------   
YOL004W_Vin13   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_W303   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_X2180-1A   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_Y55   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_YJM269   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_YJM339   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_YJM789   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_YPH499   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_YPS128   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_YPS163   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_YS9   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
YOL004W_ZTW1   51   PSLSALSTKEEDRRDSNGQQALTSHAAHILGYPPPHSNAMPSIATDSALK   100
         

YOL004W_S288C   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_AWRI796   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_BC187   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLLTVGAASFSLSRFDNPLPIK   150
YOL004W_BY4741   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_BY4742   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_CEN.PK   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   12   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   61
YOL004W_D273-10B   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_DBVPG6044   101   QPHEYHPRPKSSSSSPSINAPLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_EC1118   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_EC9-8   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLLTVGAASFSLSRFDNPLPIK   150
YOL004W_FL100   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_FY1679   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_FostersB   
   --------------------------------------------------   
YOL004W_FostersO   
   --------------------------------------------------   
YOL004W_JAY291   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_JK9-3d   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_K11   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_Kyokai7   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_L1528   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_LalvinQA23   
   --------------------------------------------------   
YOL004W_PW5   101   QPHEYHPRPKSSSSSPSINAPLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_RM11-1a   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLLTVGAASFSLSRFDNPLPIK   150
YOL004W_RedStar   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_SEY6210   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_SK1   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_T7   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_UC5   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_UWOPS05_217_3   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_VL3   1   ----------------------MNAGPAPLXTVGAASFSLSRFDNPLPIK   28
YOL004W_Vin13   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLXTVGAASFSLSRFDNPLPIK   150
YOL004W_W303   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_X2180-1A   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_Y55   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_YJM269   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_YJM339   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_YJM789   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_YPH499   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_YPS128   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_YPS163   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_YS9   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
YOL004W_ZTW1   101   QPHEYHPRPKSSSSSPSINASLMNAGPAPLPTVGAASFSLSRFDNPLPIK   150
         

YOL004W_S288C   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_AWRI796   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_BC187   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_BY4741   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_BY4742   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_CEN.PK   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHTDAN   200
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   62   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   111
YOL004W_D273-10B   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_DBVPG6044   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_EC1118   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_EC9-8   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_FL100   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_FY1679   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_FostersB   1   -----------MVFRKKKRRRNGLKIAXKFPPGVQPADAPDPSSNHADAN   39
YOL004W_FostersO   
   --------------------------------------------------   
YOL004W_JAY291   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_JK9-3d   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_K11   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_Kyokai7   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_L1528   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_LalvinQA23   
   --------------------------------------------------   
YOL004W_PW5   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_RM11-1a   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_RedStar   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_SEY6210   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_SK1   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_T7   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_UC5   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_UWOPS05_217_3   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_VL3   29   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   78
YOL004W_Vin13   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPXGVQPADAPDPSSNHADAN   200
YOL004W_W303   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_X2180-1A   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_Y55   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_YJM269   151   APVHTEEPKNYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_YJM339   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_YJM789   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_YPH499   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_YPS128   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_YPS163   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_YS9   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
YOL004W_ZTW1   151   APVHTEEPKSYNGLQEEEKATQRPQDCKEVPAGVQPADAPDPSSNHADAN   200
         

YOL004W_S288C   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_AWRI796   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_BC187   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_BY4741   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_BY4742   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_CEN.PK   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   112   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   161
YOL004W_D273-10B   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_DBVPG6044   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSLRPDIYNLFLDIMK   250
YOL004W_EC1118   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_EC9-8   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_FL100   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_FY1679   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_FostersB   40   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   89
YOL004W_FostersO   1   ------------------------------------------------MK   2
YOL004W_JAY291   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_JK9-3d   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_K11   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_Kyokai7   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_L1528   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_LalvinQA23   
   --------------------------------------------------   
YOL004W_PW5   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSLRPDIYNLFLDIMK   250
YOL004W_RM11-1a   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_RedStar   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_SEY6210   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_SK1   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_T7   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_UC5   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_UWOPS05_217_3   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_VL3   79   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   128
YOL004W_Vin13   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_W303   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_X2180-1A   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_Y55   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_YJM269   201   DDNNNNKNSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_YJM339   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_YJM789   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_YPH499   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_YPS128   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_YPS163   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_YS9   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
YOL004W_ZTW1   201   DDNNNNENSHDEDADYRPLNVKDALSYLEQVKFQFSSRPDIYNLFLDIMK   250
         

YOL004W_S288C   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_AWRI796   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_BC187   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_BY4741   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_BY4742   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_CEN.PK   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   162   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   211
YOL004W_D273-10B   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_DBVPG6044   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_EC1118   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_EC9-8   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_FL100   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_FY1679   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_FostersB   90   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   139
YOL004W_FostersO   3   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFXPQXYRIXCSSNPDDPI   52
YOL004W_JAY291   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_JK9-3d   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_K11   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_Kyokai7   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_L1528   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_LalvinQA23   
   --------------------------------------------------   
YOL004W_PW5   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_RM11-1a   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_RedStar   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_SEY6210   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_SK1   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_T7   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_UC5   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_UWOPS05_217_3   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_VL3   129   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   178
YOL004W_Vin13   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_W303   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_X2180-1A   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_Y55   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_YJM269   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_YJM339   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_YJM789   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_YPH499   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_YPS128   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_YPS163   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_YS9   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
YOL004W_ZTW1   251   DFKSQAIDTPGVIERVSTLFRGYPILIQGFNTFLPQGYRIECSSNPDDPI   300
         

YOL004W_S288C   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_AWRI796   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_BC187   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_BY4741   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_BY4742   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_CEN.PK   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   212   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   261
YOL004W_D273-10B   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_DBVPG6044   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_EC1118   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_EC9-8   301   RVTTPMGTTTVNNNISPSGRGTTDAHELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_FL100   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_FY1679   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_FostersB   140   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   189
YOL004W_FostersO   53   RVTTPMXTTTVNNNISPSGRGTTDAQELGSFPESDXNGVQQPSNVPMVPS   102
YOL004W_JAY291   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_JK9-3d   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_K11   301   RVTTPMGTTTVNNNISPSGRDTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_Kyokai7   301   RVTTPMGTTTVNNNISPSGRDTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_L1528   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_LalvinQA23   1   -----MGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   45
YOL004W_PW5   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_RM11-1a   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_RedStar   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_SEY6210   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_SK1   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_T7   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_UC5   301   RVTTPMGTTTVNNNISPSGRDTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_UWOPS05_217_3   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_VL3   179   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   228
YOL004W_Vin13   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_W303   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_X2180-1A   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_Y55   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_YJM269   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_YJM339   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_YJM789   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_YPH499   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_YPS128   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_YPS163   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_YS9   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
YOL004W_ZTW1   301   RVTTPMGTTTVNNNISPSGRGTTDAQELGSFPESDGNGVQQPSNVPMVPS   350
         

YOL004W_S288C   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_AWRI796   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_BC187   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_BY4741   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_BY4742   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_CEN.PK   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMSAHRQIPQSQSLVPQEDV   400
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   262   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   311
YOL004W_D273-10B   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_DBVPG6044   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQNPQSQSLVPQEDV   400
YOL004W_EC1118   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_EC9-8   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_FL100   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_FY1679   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_FostersB   190   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   239
YOL004W_FostersO   103   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLXPQEDV   152
YOL004W_JAY291   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_JK9-3d   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMSAHRQIPQSQSLVPQEDV   400
YOL004W_K11   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_Kyokai7   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_L1528   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_LalvinQA23   46   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   95
YOL004W_PW5   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQKDV   400
YOL004W_RM11-1a   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_RedStar   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_SEY6210   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_SK1   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_T7   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_UC5   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_UWOPS05_217_3   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_VL3   229   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   278
YOL004W_Vin13   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_W303   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_X2180-1A   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDA   400
YOL004W_Y55   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_YJM269   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_YJM339   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEIPAHRQIPQSQSLVPQEDV   400
YOL004W_YJM789   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_YPH499   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMSAHRQIPQSQSLVPQEDV   400
YOL004W_YPS128   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_YPS163   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
YOL004W_YS9   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMSAHRQIPQSQSLVPQEDV   400
YOL004W_ZTW1   351   SVYQSEQNQDQQQSLPLLATSSGLPSIQQPEMPAHRQIPQSQSLVPQEDV   400
         

YOL004W_S288C   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_AWRI796   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_BC187   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_BY4741   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_BY4742   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_CEN.PK   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   312   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   361
YOL004W_D273-10B   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_DBVPG6044   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_EC1118   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_EC9-8   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_FL100   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_FY1679   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_FostersB   240   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   289
YOL004W_FostersO   153   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   202
YOL004W_JAY291   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_JK9-3d   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_K11   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_Kyokai7   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_L1528   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_LalvinQA23   96   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   145
YOL004W_PW5   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_RM11-1a   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_RedStar   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_SEY6210   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_SK1   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_T7   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_UC5   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_UWOPS05_217_3   401   KKNVDVEFSQAISYVNKIKTRFADQPDTYKHFLEILQTYQREQKPINEVY   450
YOL004W_VL3   279   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   328
YOL004W_Vin13   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_W303   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_X2180-1A   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_Y55   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_YJM269   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_YJM339   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_YJM789   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_YPH499   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_YPS128   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_YPS163   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_YS9   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
YOL004W_ZTW1   401   KKNVDVEFSQAISYVNKIKTRFADQPDIYKHFLEILQTYQREQKPINEVY   450
         

YOL004W_S288C   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_AWRI796   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_BC187   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_BY4741   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_BY4742   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_CEN.PK   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   362   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   411
YOL004W_D273-10B   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_DBVPG6044   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAH   500
YOL004W_EC1118   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_EC9-8   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_FL100   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_FY1679   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_FostersB   290   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   339
YOL004W_FostersO   203   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   252
YOL004W_JAY291   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_JK9-3d   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_K11   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_Kyokai7   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_L1528   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_LalvinQA23   146   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   195
YOL004W_PW5   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAH   500
YOL004W_RM11-1a   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_RedStar   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_SEY6210   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_SK1   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_T7   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_UC5   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_UWOPS05_217_3   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_VL3   329   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   378
YOL004W_Vin13   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_W303   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_X2180-1A   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_Y55   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_YJM269   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHARQHAQQQHEAQMHAQ   500
YOL004W_YJM339   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_YJM789   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_YPH499   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_YPS128   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_YPS163   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_YS9   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
YOL004W_ZTW1   451   AQVTHLFQNAPDLLEDFKKFLPDSSASANQQVQHAQQHAQQQHEAQMHAQ   500
         

YOL004W_S288C   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_AWRI796   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_BC187   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_BY4741   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_BY4742   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_CEN.PK   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   412   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   453
YOL004W_D273-10B   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_DBVPG6044   501   AQVEQ----------------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   534
YOL004W_EC1118   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_EC9-8   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_FL100   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_FY1679   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_FostersB   340   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   381
YOL004W_FostersO   253   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   294
YOL004W_JAY291   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_JK9-3d   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_K11   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_Kyokai7   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_L1528   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_LalvinQA23   196   AQAQAQAQAQAQVEQ------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   239
YOL004W_PW5   501   AQVEQ----------------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   534
YOL004W_RM11-1a   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_RedStar   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_SEY6210   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_SK1   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_T7   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_UC5   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_UWOPS05_217_3   501   AQAQAQAQAQAQAQAQAQVEQQKQQQQFLYPASGYYGHPSNRGIPQQNLP   550
YOL004W_VL3   379   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   420
YOL004W_Vin13   501   AQAQAQAQAQAQVEQ------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   544
YOL004W_W303   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_X2180-1A   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_Y55   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_YJM269   501   AQAQAQAQAQAQVEQ------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   544
YOL004W_YJM339   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_YJM789   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_YPH499   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_YPS128   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_YPS163   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_YS9   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
YOL004W_ZTW1   501   AQAQAQAQAQVEQ--------QKQQQQFLYPASGYYGHPSNRGIPQQNLP   542
         

YOL004W_S288C   543   PIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANE   592
YOL004W_AWRI796   543   PIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANE   592
YOL004W_BC187   543   PIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANE   592
YOL004W_BY4741   543   PIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANE   592
YOL004W_BY4742   543   PIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANE   592
YOL004W_CEN.PK   543   PIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSMVQHGPNMVHQGIANE   592
YOL004W_CLIB215   
   --------------------------------------------------   
YOL004W_CLIB324   454   PIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIANE   503
YOL004W_D273-10B   543   PIGSFSPPTNGSTVHEAYQDQQHMQPPHFMPLPSIVQHGPNMVHQGIAN