POP2/YNR052C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YNR052C_S288C   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_AWRI796   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_BC187   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_BY4741   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_BY4742   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_CEN.PK   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_CLIB215   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_D273-10B   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_DBVPG6044   1   ---MNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_EC1118   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_EC9-8   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   50
YNR052C_FL100   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_FY1679   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_FostersB   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPXVNRARMFPQ   50
YNR052C_FostersO   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_JAY291   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_JK9-3d   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_K11   1   ---MNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_Kyokai7   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   50
YNR052C_L1528   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_LalvinQA23   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPXVNRARMFPQ   50
YNR052C_PW5   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   50
YNR052C_RM11-1a   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_RedStar   1   ---MNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_SEY6210   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_SK1   1   ---MNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_T7   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   50
YNR052C_UWOPS05_217_3   1   ---MNVQPRVLAVEGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_VL3   
   --------------------------------------------------   
YNR052C_Vin13   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_W303   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_X2180-1A   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_Y55   1   ---MNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_YJM269   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   50
YNR052C_YJM339   1   ---MNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_YJM789   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   50
YNR052C_YPH499   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVNRARMFPQ   50
YNR052C_YPS128   1   ---MNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_YPS163   1   ---MNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   47
YNR052C_YS9   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPKVTRARMFPQ   50
YNR052C_ZTW1   1   MQSMNVQPRVLAVGGEQFFSQRQASEQHQQQNMGPQVYSPQVNRARMFPQ   50
         

YNR052C_S288C   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_AWRI796   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_BC187   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_BY4741   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_BY4742   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_CEN.PK   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_CLIB215   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_D273-10B   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_DBVPG6044   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_EC1118   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_EC9-8   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_FL100   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_FY1679   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_FostersB   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_FostersO   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_JAY291   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_JK9-3d   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_K11   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_Kyokai7   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_L1528   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_LalvinQA23   51   GMPVNTINGSVNQEMNNAXLLKQKNEPLLTQQQQQQQQQQQQQQQQQQQQ   100
YNR052C_PW5   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_RM11-1a   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_RedStar   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_SEY6210   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_SK1   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_T7   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_UWOPS05_217_3   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_VL3   1   ----------------MPIFLKQKNEPLLTQQQQQQ-----------QQQ   23
YNR052C_Vin13   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_W303   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_X2180-1A   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_Y55   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_YJM269   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_YJM339   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_YJM789   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQQQQQQQQQQQQQQQ   100
YNR052C_YPH499   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_YPS128   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_YPS163   48   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   86
YNR052C_YS9   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
YNR052C_ZTW1   51   GMPVNTINGSVNQEMNNAYLLKQKNEPLLTQQQQQQ-----------QQQ   89
         

YNR052C_S288C   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_AWRI796   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_BC187   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_BY4741   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_BY4742   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_CEN.PK   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_CLIB215   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_D273-10B   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_DBVPG6044   87   QQQQQQQQQQQQQQQQQQQQQQQ--------QPFNIGTPVSVASLPPGLN   128
YNR052C_EC1118   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_EC9-8   90   QQQQQQQQQQQQQQQQQQ--------------PFNIGTPVSVASLPPGLN   125
YNR052C_FL100   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_FY1679   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_FostersB   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_FostersO   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_JAY291   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_JK9-3d   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_K11   87   QQQQQQQQQQQQQQQQQ--------------QPFNIGTPVSVASLPPGLN   122
YNR052C_Kyokai7   90   QQQQQQQQQQQQQQQQQQ--------------PFNIGTPVSVASLPPGLN   125
YNR052C_L1528   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_LalvinQA23   101   QQ------------------------------PFNIGTPVSVASLPPGLN   120
YNR052C_PW5   90   QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPFNIGTPVSVASLPPGLN   139
YNR052C_RM11-1a   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_RedStar   87   QQQQQQQQQQQQQ-------------------PFNIGTPVSVASLPPGLN   117
YNR052C_SEY6210   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_SK1   87   QQQQQQQQQQQQQQQQQQ--------------PFNIGTPVSVASLPPGLN   122
YNR052C_T7   90   QQQQQQQQQQQQQQQQQQ--------------PFNIGTPVSVASLPPGLN   125
YNR052C_UWOPS05_217_3   87   QQQQQQQQQQQ---------------------PFNIGTPVSVASLPPGLN   115
YNR052C_VL3   24   QQ------------------------------PFNIGTPVSVASLPPGLN   43
YNR052C_Vin13   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_W303   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_X2180-1A   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_Y55   87   QQQQQQQQQQQQQQQQQQQQQQQ--------QPFNIGTPVSVASLPPGLN   128
YNR052C_YJM269   90   QQQQQQQQQQQQQQQQQQQQQ----------QPFNIGTPVSVASLPPGLN   129
YNR052C_YJM339   87   QQQQQQQQQQQQQQQQQQQQQ-----------PFNIGTPVSVASLPPGLN   125
YNR052C_YJM789   101   QQ------------------------------PFNIGTPVSVASLPPGLN   120
YNR052C_YPH499   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_YPS128   87   QQQQQQQQQQQQQ-------------------PFNIGTPVSVASLPPGLN   117
YNR052C_YPS163   87   QQQQQQQQQQQQQ-------------------PFNIGTPVSVASLPPGLN   117
YNR052C_YS9   90   QQ------------------------------PFNIGTPVSVASLPPGLN   109
YNR052C_ZTW1   90   QQQQQQQQQQQQQQQQQQ--------------PFNIGTPVSVASLPPGLN   125
         

YNR052C_S288C   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_AWRI796   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_BC187   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_BY4741   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_BY4742   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_CEN.PK   110   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   149
YNR052C_CLIB215   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_D273-10B   110   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   149
YNR052C_DBVPG6044   129   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   168
YNR052C_EC1118   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_EC9-8   126   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   165
YNR052C_FL100   110   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   149
YNR052C_FY1679   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_FostersB   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_FostersO   110   VLQQQQQQQQQQQQQQQQQQQQGVGLNRPLASQLPKHLTNQSMPPIFLPP   159
YNR052C_JAY291   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_JK9-3d   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_K11   123   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   162
YNR052C_Kyokai7   126   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   165
YNR052C_L1528   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_LalvinQA23   121   VLQQQQQQQQQQQQQ-----QQGVXLNRPLASQLPKHLTNQSMPPIFLPP   165
YNR052C_PW5   140   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   179
YNR052C_RM11-1a   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_RedStar   118   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   157
YNR052C_SEY6210   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_SK1   123   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   162
YNR052C_T7   126   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   165
YNR052C_UWOPS05_217_3   116   VLQQQQQQQQQQ----------GVGLNRPLASQLSKHLTNQSMPPIFLPP   155
YNR052C_VL3   44   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   88
YNR052C_Vin13   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_W303   110   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   149
YNR052C_X2180-1A   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_Y55   129   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   168
YNR052C_YJM269   130   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   169
YNR052C_YJM339   126   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   165
YNR052C_YJM789   121   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   165
YNR052C_YPH499   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_YPS128   118   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   157
YNR052C_YPS163   118   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   157
YNR052C_YS9   110   VLQQQQQQQQQQQQQ-----QQGVGLNRPLASQLPKHLTNQSMPPIFLPP   154
YNR052C_ZTW1   126   VLQQQQQQQQQQ----------GVGLNRPLASQLPKHLTNQSMPPIFLPP   165
         

YNR052C_S288C   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_AWRI796   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_BC187   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_BY4741   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_BY4742   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_CEN.PK   150   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   199
YNR052C_CLIB215   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_D273-10B   150   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   199
YNR052C_DBVPG6044   169   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   218
YNR052C_EC1118   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_EC9-8   166   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   215
YNR052C_FL100   150   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   199
YNR052C_FY1679   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_FostersB   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_FostersO   160   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   209
YNR052C_JAY291   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_JK9-3d   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_K11   163   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   212
YNR052C_Kyokai7   166   PNYLFVRDVWKSNLYSDFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   215
YNR052C_L1528   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_LalvinQA23   166   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   215
YNR052C_PW5   180   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   229
YNR052C_RM11-1a   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_RedStar   158   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   207
YNR052C_SEY6210   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_SK1   163   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   212
YNR052C_T7   166   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   215
YNR052C_UWOPS05_217_3   156   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   205
YNR052C_VL3   89   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   138
YNR052C_Vin13   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_W303   150   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   199
YNR052C_X2180-1A   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_Y55   169   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   218
YNR052C_YJM269   170   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   219
YNR052C_YJM339   166   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   215
YNR052C_YJM789   166   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   215
YNR052C_YPH499   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_YPS128   158   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   207
YNR052C_YPS163   158   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   207
YNR052C_YS9   155   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   204
YNR052C_ZTW1   166   PNYLFVRDVWKSNLYSEFAVIRQLVSQYNHVSISTEFVGTLARPIGTFRS   215
         

YNR052C_S288C   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_AWRI796   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_BC187   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_BY4741   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_BY4742   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_CEN.PK   200   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   249
YNR052C_CLIB215   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_D273-10B   200   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   249
YNR052C_DBVPG6044   219   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   268
YNR052C_EC1118   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_EC9-8   216   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   265
YNR052C_FL100   200   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   249
YNR052C_FY1679   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_FostersB   205   KVDYHYQTMRANVDFLNPIQLGLSLSDXNXNKPDNGPSTWQFNFEFDPKK   254
YNR052C_FostersO   210   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   259
YNR052C_JAY291   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_JK9-3d   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_K11   213   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   262
YNR052C_Kyokai7   216   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   265
YNR052C_L1528   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_LalvinQA23   216   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   265
YNR052C_PW5   230   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   279
YNR052C_RM11-1a   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_RedStar   208   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   257
YNR052C_SEY6210   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_SK1   213   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   262
YNR052C_T7   216   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   265
YNR052C_UWOPS05_217_3   206   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   255
YNR052C_VL3   139   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   188
YNR052C_Vin13   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_W303   200   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   249
YNR052C_X2180-1A   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_Y55   219   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   268
YNR052C_YJM269   220   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   269
YNR052C_YJM339   216   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   265
YNR052C_YJM789   216   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   265
YNR052C_YPH499   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_YPS128   208   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   257
YNR052C_YPS163   208   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   257
YNR052C_YS9   205   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   254
YNR052C_ZTW1   216   KVDYHYQTMRANVDFLNPIQLGLSLSDANGNKPDNGPSTWQFNFEFDPKK   265
         

YNR052C_S288C   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_AWRI796   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_BC187   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_BY4741   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_BY4742   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_CEN.PK   250   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   299
YNR052C_CLIB215   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_D273-10B   250   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   299
YNR052C_DBVPG6044   269   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   318
YNR052C_EC1118   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_EC9-8   266   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   315
YNR052C_FL100   250   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   299
YNR052C_FY1679   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_FostersB   255   EIMXTESLELLRKSXINFRKTRKXRXRCI---------------------   283
YNR052C_FostersO   260   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   309
YNR052C_JAY291   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_JK9-3d   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_K11   263   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   312
YNR052C_Kyokai7   266   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   315
YNR052C_L1528   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_LalvinQA23   266   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   315
YNR052C_PW5   280   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   329
YNR052C_RM11-1a   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_RedStar   258   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   307
YNR052C_SEY6210   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_SK1   263   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   312
YNR052C_T7   266   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   315
YNR052C_UWOPS05_217_3   256   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   305
YNR052C_VL3   189   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   238
YNR052C_Vin13   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_W303   250   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   299
YNR052C_X2180-1A   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_Y55   269   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   318
YNR052C_YJM269   270   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   319
YNR052C_YJM339   266   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   315
YNR052C_YJM789   266   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   315
YNR052C_YPH499   255   EIMSTESLELLRKSGINFEKHENLGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_YPS128   258   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   307
YNR052C_YPS163   258   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   307
YNR052C_YS9   255   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   304
YNR052C_ZTW1   266   EIMSTESLELLRKSGINFEKHENSGIDVFEFSQLLMDSGLMMDDSVTWIT   315
         

YNR052C_S288C   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_AWRI796   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_BC187   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_BY4741   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_BY4742   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_CEN.PK   300   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   349
YNR052C_CLIB215   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQVF   354
YNR052C_D273-10B   300   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   349
YNR052C_DBVPG6044   319   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   368
YNR052C_EC1118   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_EC9-8   316   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   365
YNR052C_FL100   300   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   349
YNR052C_FY1679   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_FostersB   
   --------------------------------------------------   
YNR052C_FostersO   310   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   359
YNR052C_JAY291   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_JK9-3d   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_K11   313   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   362
YNR052C_Kyokai7   316   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   365
YNR052C_L1528   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_LalvinQA23   316   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   365
YNR052C_PW5   330   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   379
YNR052C_RM11-1a   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_RedStar   308   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   357
YNR052C_SEY6210   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_SK1   313   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   362
YNR052C_T7   316   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   365
YNR052C_UWOPS05_217_3   306   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   355
YNR052C_VL3   239   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   288
YNR052C_Vin13   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_W303   300   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   349
YNR052C_X2180-1A   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_Y55   319   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   368
YNR052C_YJM269   320   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   369
YNR052C_YJM339   316   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   365
YNR052C_YJM789   316   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   365
YNR052C_YPH499   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_YPS128   308   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   357
YNR052C_YPS163   308   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   357
YNR052C_YS9   305   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   354
YNR052C_ZTW1   316   YHAAYDLGFLINILMNDSMPNNKEDFEWWVHQYMPNFYDLNLVYKIIQEF   365
         

YNR052C_S288C   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_AWRI796   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_BC187   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_BY4741   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_BY4742   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_CEN.PK   350   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   399
YNR052C_CLIB215   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_D273-10B   350   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   399
YNR052C_DBVPG6044   369   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   418
YNR052C_EC1118   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_EC9-8   366   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   415
YNR052C_FL100   350   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   399
YNR052C_FY1679   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_FostersB   
   --------------------------------------------------   
YNR052C_FostersO   360   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   409
YNR052C_JAY291   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_JK9-3d   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_K11   363   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   412
YNR052C_Kyokai7   366   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   415
YNR052C_L1528   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_LalvinQA23   366   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   415
YNR052C_PW5   380   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   429
YNR052C_RM11-1a   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_RedStar   358   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   407
YNR052C_SEY6210   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_SK1   363   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   412
YNR052C_T7   366   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   415
YNR052C_UWOPS05_217_3   356   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   405
YNR052C_VL3   289   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   338
YNR052C_Vin13   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_W303   350   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   399
YNR052C_X2180-1A   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_Y55   369   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   418
YNR052C_YJM269   370   KNPQLQQSSQQQQQQQYSLNTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   419
YNR052C_YJM339   366   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   415
YNR052C_YJM789   366   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   415
YNR052C_YPH499   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_YPS128   358   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   407
YNR052C_YPS163   358   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   407
YNR052C_YS9   355   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   404
YNR052C_ZTW1   366   KNPQLQQSSQQQQQQQYSLTTLADELGLPRFSIFTTTGGQSLLMLLSFCQ   415
         

YNR052C_S288C   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_AWRI796   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_BC187   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_BY4741   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_BY4742   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_CEN.PK   400   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   428
YNR052C_CLIB215   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_D273-10B   400   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   428
YNR052C_DBVPG6044   419   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   447
YNR052C_EC1118   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_EC9-8   416   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   444
YNR052C_FL100   400   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   428
YNR052C_FY1679   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_FostersB   
   -----------------------------   
YNR052C_FostersO   410   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   438
YNR052C_JAY291   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_JK9-3d   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_K11   413   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   441
YNR052C_Kyokai7   416   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   444
YNR052C_L1528   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_LalvinQA23   416   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   444
YNR052C_PW5   430   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   458
YNR052C_RM11-1a   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_RedStar   408   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   436
YNR052C_SEY6210   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_SK1   413   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   441
YNR052C_T7   416   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   444
YNR052C_UWOPS05_217_3   406   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   434
YNR052C_VL3   339   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   367
YNR052C_Vin13   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_W303   400   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   428
YNR052C_X2180-1A   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_Y55   419   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   447
YNR052C_YJM269   420   LSKLSMHKFPNGTDFAKYQGVIYGIDGNQ   448
YNR052C_YJM339   416   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   444
YNR052C_YJM789   416   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   444
YNR052C_YPH499   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_YPS128   408   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   436
YNR052C_YPS163   408   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   436
YNR052C_YS9   405   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   433
YNR052C_ZTW1   416   LSKLSMHKFPNGTDFAKYQGVIYGIDGDQ   444
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YNR052C_S288C from SGD:

YNR052C_S288C [source=SGD]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_AWRI796 from AWRI:

YNR052C_AWRI796 [source=AWRI]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_BC187 from Stanford:

YNR052C_BC187 [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_BY4741 from Stanford:

YNR052C_BY4741 [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_BY4742 from Stanford:

YNR052C_BY4742 [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_CEN.PK from Stanford:

YNR052C_CEN.PK [source=Stanford]  Length: 429  Thu Sep 21 07:53:58 2017  Type: P  Check: 9937  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QGVGLNRPLA SQLPKHLTNQ SMPPIFLPPP

     151  NYLFVRDVWK SNLYSEFAVI RQLVSQYNHV SISTEFVGTL ARPIGTFRSK

     201  VDYHYQTMRA NVDFLNPIQL GLSLSDANGN KPDNGPSTWQ FNFEFDPKKE

     251  IMSTESLELL RKSGINFEKH ENLGIDVFEF SQLLMDSGLM MDDSVTWITY

     301  HAAYDLGFLI NILMNDSMPN NKEDFEWWVH QYMPNFYDLN LVYKIIQEFK

     351  NPQLQQSSQQ QQQQQYSLTT LADELGLPRF SIFTTTGGQS LLMLLSFCQL

     401  SKLSMHKFPN GTDFAKYQGV IYGIDGDQ*

Protein Sequence for YNR052C_CLIB215 from WashU:

YNR052C_CLIB215 [source=WashU]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4274  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQVFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_D273-10B from Stanford:

YNR052C_D273-10B [source=Stanford]  Length: 429  Thu Sep 21 07:53:58 2017  Type: P  Check: 9937  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QGVGLNRPLA SQLPKHLTNQ SMPPIFLPPP

     151  NYLFVRDVWK SNLYSEFAVI RQLVSQYNHV SISTEFVGTL ARPIGTFRSK

     201  VDYHYQTMRA NVDFLNPIQL GLSLSDANGN KPDNGPSTWQ FNFEFDPKKE

     251  IMSTESLELL RKSGINFEKH ENLGIDVFEF SQLLMDSGLM MDDSVTWITY

     301  HAAYDLGFLI NILMNDSMPN NKEDFEWWVH QYMPNFYDLN LVYKIIQEFK

     351  NPQLQQSSQQ QQQQQYSLTT LADELGLPRF SIFTTTGGQS LLMLLSFCQL

     401  SKLSMHKFPN GTDFAKYQGV IYGIDGDQ*

Protein Sequence for YNR052C_DBVPG6044 from Stanford:

YNR052C_DBVPG6044 [source=Stanford]  Length: 448  Thu Sep 21 07:53:58 2017  Type: P  Check: 2489  ..

       1  MNVQPRVLAV GGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQQQQ PFNIGTPVSV ASLPPGLNVL QQQQQQQQQQ GVGLNRPLAS

     151  QLPKHLTNQS MPPIFLPPPN YLFVRDVWKS NLYSEFAVIR QLVSQYNHVS

     201  ISTEFVGTLA RPIGTFRSKV DYHYQTMRAN VDFLNPIQLG LSLSDANGNK

     251  PDNGPSTWQF NFEFDPKKEI MSTESLELLR KSGINFEKHE NSGIDVFEFS

     301  QLLMDSGLMM DDSVTWITYH AAYDLGFLIN ILMNDSMPNN KEDFEWWVHQ

     351  YMPNFYDLNL VYKIIQEFKN PQLQQSSQQQ QQQQYSLTTL ADELGLPRFS

     401  IFTTTGGQSL LMLLSFCQLS KLSMHKFPNG TDFAKYQGVI YGIDGDQ*


Protein Sequence for YNR052C_EC1118 from Genoscope:

YNR052C_EC1118 [source=Genoscope]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_EC9-8 from ASinica:

YNR052C_EC9-8 [source=ASinica]  Length: 445  Thu Sep 21 07:53:58 2017  Type: P  Check: 8157  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP QVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQPFN IGTPVSVASL PPGLNVLQQQ QQQQQQQGVG LNRPLASQLP

     151  KHLTNQSMPP IFLPPPNYLF VRDVWKSNLY SEFAVIRQLV SQYNHVSIST

     201  EFVGTLARPI GTFRSKVDYH YQTMRANVDF LNPIQLGLSL SDANGNKPDN

     251  GPSTWQFNFE FDPKKEIMST ESLELLRKSG INFEKHENSG IDVFEFSQLL

     301  MDSGLMMDDS VTWITYHAAY DLGFLINILM NDSMPNNKED FEWWVHQYMP

     351  NFYDLNLVYK IIQEFKNPQL QQSSQQQQQQ QYSLTTLADE LGLPRFSIFT

     401  TTGGQSLLML LSFCQLSKLS MHKFPNGTDF AKYQGVIYGI DGDQ*


Protein Sequence for YNR052C_FL100 from Stanford:

YNR052C_FL100 [source=Stanford]  Length: 429  Thu Sep 21 07:53:58 2017  Type: P  Check: 9937  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QGVGLNRPLA SQLPKHLTNQ SMPPIFLPPP

     151  NYLFVRDVWK SNLYSEFAVI RQLVSQYNHV SISTEFVGTL ARPIGTFRSK

     201  VDYHYQTMRA NVDFLNPIQL GLSLSDANGN KPDNGPSTWQ FNFEFDPKKE

     251  IMSTESLELL RKSGINFEKH ENLGIDVFEF SQLLMDSGLM MDDSVTWITY

     301  HAAYDLGFLI NILMNDSMPN NKEDFEWWVH QYMPNFYDLN LVYKIIQEFK

     351  NPQLQQSSQQ QQQQQYSLTT LADELGLPRF SIFTTTGGQS LLMLLSFCQL

     401  SKLSMHKFPN GTDFAKYQGV IYGIDGDQ*

Protein Sequence for YNR052C_FY1679 from Stanford:

YNR052C_FY1679 [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_FostersB from AWRI:

YNR052C_FostersB [source=AWRI]  Length: 284  Thu Sep 21 07:53:58 2017  Type: P  Check: 1108  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP XVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DXNXNKPDNG PSTWQFNFEF

     251  DPKKEIMXTE SLELLRKSXI NFRKTRKXRX RCI*

Protein Sequence for YNR052C_FostersO from AWRI:

YNR052C_FostersO [source=AWRI]  Length: 439  Thu Sep 21 07:53:58 2017  Type: P  Check: 8723  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQQQQQ QGVGLNRPLA SQLPKHLTNQ

     151  SMPPIFLPPP NYLFVRDVWK SNLYSEFAVI RQLVSQYNHV SISTEFVGTL

     201  ARPIGTFRSK VDYHYQTMRA NVDFLNPIQL GLSLSDANGN KPDNGPSTWQ

     251  FNFEFDPKKE IMSTESLELL RKSGINFEKH ENLGIDVFEF SQLLMDSGLM

     301  MDDSVTWITY HAAYDLGFLI NILMNDSMPN NKEDFEWWVH QYMPNFYDLN

     351  LVYKIIQEFK NPQLQQSSQQ QQQQQYSLTT LADELGLPRF SIFTTTGGQS

     401  LLMLLSFCQL SKLSMHKFPN GTDFAKYQGV IYGIDGDQ*

Protein Sequence for YNR052C_JAY291 from Duke:

YNR052C_JAY291 [source=Duke]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_JK9-3d from Stanford:

YNR052C_JK9-3d [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_K11 from Stanford:

YNR052C_K11 [source=Stanford]  Length: 442  Thu Sep 21 07:53:58 2017  Type: P  Check: 9995  ..

       1  MNVQPRVLAV GGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQPFNIGT PVSVASLPPG LNVLQQQQQQ QQQQGVGLNR PLASQLPKHL

     151  TNQSMPPIFL PPPNYLFVRD VWKSNLYSEF AVIRQLVSQY NHVSISTEFV

     201  GTLARPIGTF RSKVDYHYQT MRANVDFLNP IQLGLSLSDA NGNKPDNGPS

     251  TWQFNFEFDP KKEIMSTESL ELLRKSGINF EKHENSGIDV FEFSQLLMDS

     301  GLMMDDSVTW ITYHAAYDLG FLINILMNDS MPNNKEDFEW WVHQYMPNFY

     351  DLNLVYKIIQ EFKNPQLQQS SQQQQQQQYS LTTLADELGL PRFSIFTTTG

     401  GQSLLMLLSF CQLSKLSMHK FPNGTDFAKY QGVIYGIDGD Q*


Protein Sequence for YNR052C_Kyokai7 from NRIB:

YNR052C_Kyokai7 [source=NRIB]  Length: 445  Thu Sep 21 07:53:58 2017  Type: P  Check: 8146  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP QVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQPFN IGTPVSVASL PPGLNVLQQQ QQQQQQQGVG LNRPLASQLP

     151  KHLTNQSMPP IFLPPPNYLF VRDVWKSNLY SDFAVIRQLV SQYNHVSIST

     201  EFVGTLARPI GTFRSKVDYH YQTMRANVDF LNPIQLGLSL SDANGNKPDN

     251  GPSTWQFNFE FDPKKEIMST ESLELLRKSG INFEKHENSG IDVFEFSQLL

     301  MDSGLMMDDS VTWITYHAAY DLGFLINILM NDSMPNNKED FEWWVHQYMP

     351  NFYDLNLVYK IIQEFKNPQL QQSSQQQQQQ QYSLTTLADE LGLPRFSIFT

     401  TTGGQSLLML LSFCQLSKLS MHKFPNGTDF AKYQGVIYGI DGDQ*


Protein Sequence for YNR052C_L1528 from Stanford:

YNR052C_L1528 [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_LalvinQA23 from AWRI:

YNR052C_LalvinQA23 [source=AWRI]  Length: 445  Thu Sep 21 07:53:58 2017  Type: P  Check: 9022  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP XVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAXL LKQKNEPLLT QQQQQQQQQQ QQQQQQQQQQ

     101  QQPFNIGTPV SVASLPPGLN VLQQQQQQQQ QQQQQQQGVX LNRPLASQLP

     151  KHLTNQSMPP IFLPPPNYLF VRDVWKSNLY SEFAVIRQLV SQYNHVSIST

     201  EFVGTLARPI GTFRSKVDYH YQTMRANVDF LNPIQLGLSL SDANGNKPDN

     251  GPSTWQFNFE FDPKKEIMST ESLELLRKSG INFEKHENLG IDVFEFSQLL

     301  MDSGLMMDDS VTWITYHAAY DLGFLINILM NDSMPNNKED FEWWVHQYMP

     351  NFYDLNLVYK IIQEFKNPQL QQSSQQQQQQ QYSLTTLADE LGLPRFSIFT

     401  TTGGQSLLML LSFCQLSKLS MHKFPNGTDF AKYQGVIYGI DGDQ*


Protein Sequence for YNR052C_PW5 from WashU:

YNR052C_PW5 [source=WashU]  Length: 459  Thu Sep 21 07:53:58 2017  Type: P  Check: 9195  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP QVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQQQQ QQQQQQQQQQ QPFNIGTPVS VASLPPGLNV LQQQQQQQQQ

     151  QGVGLNRPLA SQLPKHLTNQ SMPPIFLPPP NYLFVRDVWK SNLYSEFAVI

     201  RQLVSQYNHV SISTEFVGTL ARPIGTFRSK VDYHYQTMRA NVDFLNPIQL

     251  GLSLSDANGN KPDNGPSTWQ FNFEFDPKKE IMSTESLELL RKSGINFEKH

     301  ENSGIDVFEF SQLLMDSGLM MDDSVTWITY HAAYDLGFLI NILMNDSMPN

     351  NKEDFEWWVH QYMPNFYDLN LVYKIIQEFK NPQLQQSSQQ QQQQQYSLTT

     401  LADELGLPRF SIFTTTGGQS LLMLLSFCQL SKLSMHKFPN GTDFAKYQGV

     451  IYGIDGDQ*

Protein Sequence for YNR052C_RM11-1a from Stanford:

YNR052C_RM11-1a [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_RedStar from Stanford:

YNR052C_RedStar [source=Stanford]  Length: 437  Thu Sep 21 07:53:58 2017  Type: P  Check: 4456  ..

       1  MNVQPRVLAV GGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQQQP

     101  FNIGTPVSVA SLPPGLNVLQ QQQQQQQQQG VGLNRPLASQ LPKHLTNQSM

     151  PPIFLPPPNY LFVRDVWKSN LYSEFAVIRQ LVSQYNHVSI STEFVGTLAR

     201  PIGTFRSKVD YHYQTMRANV DFLNPIQLGL SLSDANGNKP DNGPSTWQFN

     251  FEFDPKKEIM STESLELLRK SGINFEKHEN SGIDVFEFSQ LLMDSGLMMD

     301  DSVTWITYHA AYDLGFLINI LMNDSMPNNK EDFEWWVHQY MPNFYDLNLV

     351  YKIIQEFKNP QLQQSSQQQQ QQQYSLTTLA DELGLPRFSI FTTTGGQSLL

     401  MLLSFCQLSK LSMHKFPNGT DFAKYQGVIY GIDGDQ*

Protein Sequence for YNR052C_SEY6210 from Stanford:

YNR052C_SEY6210 [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_SK1 from Stanford:

YNR052C_SK1 [source=Stanford]  Length: 442  Thu Sep 21 07:53:58 2017  Type: P  Check: 9995  ..

       1  MNVQPRVLAV GGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQPFNIGT PVSVASLPPG LNVLQQQQQQ QQQQGVGLNR PLASQLPKHL

     151  TNQSMPPIFL PPPNYLFVRD VWKSNLYSEF AVIRQLVSQY NHVSISTEFV

     201  GTLARPIGTF RSKVDYHYQT MRANVDFLNP IQLGLSLSDA NGNKPDNGPS

     251  TWQFNFEFDP KKEIMSTESL ELLRKSGINF EKHENSGIDV FEFSQLLMDS

     301  GLMMDDSVTW ITYHAAYDLG FLINILMNDS MPNNKEDFEW WVHQYMPNFY

     351  DLNLVYKIIQ EFKNPQLQQS SQQQQQQQYS LTTLADELGL PRFSIFTTTG

     401  GQSLLMLLSF CQLSKLSMHK FPNGTDFAKY QGVIYGIDGD Q*


Protein Sequence for YNR052C_T7 from WashU:

YNR052C_T7 [source=WashU]  Length: 445  Thu Sep 21 07:53:58 2017  Type: P  Check: 8157  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP QVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQPFN IGTPVSVASL PPGLNVLQQQ QQQQQQQGVG LNRPLASQLP

     151  KHLTNQSMPP IFLPPPNYLF VRDVWKSNLY SEFAVIRQLV SQYNHVSIST

     201  EFVGTLARPI GTFRSKVDYH YQTMRANVDF LNPIQLGLSL SDANGNKPDN

     251  GPSTWQFNFE FDPKKEIMST ESLELLRKSG INFEKHENSG IDVFEFSQLL

     301  MDSGLMMDDS VTWITYHAAY DLGFLINILM NDSMPNNKED FEWWVHQYMP

     351  NFYDLNLVYK IIQEFKNPQL QQSSQQQQQQ QYSLTTLADE LGLPRFSIFT

     401  TTGGQSLLML LSFCQLSKLS MHKFPNGTDF AKYQGVIYGI DGDQ*


Protein Sequence for YNR052C_UWOPS05_217_3 from Stanford:

YNR052C_UWOPS05_217_3 [source=Stanford]  Length: 435  Thu Sep 21 07:53:58 2017  Type: P  Check: 7313  ..

       1  MNVQPRVLAV EGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQPFN

     101  IGTPVSVASL PPGLNVLQQQ QQQQQQQGVG LNRPLASQLS KHLTNQSMPP

     151  IFLPPPNYLF VRDVWKSNLY SEFAVIRQLV SQYNHVSIST EFVGTLARPI

     201  GTFRSKVDYH YQTMRANVDF LNPIQLGLSL SDANGNKPDN GPSTWQFNFE

     251  FDPKKEIMST ESLELLRKSG INFEKHENSG IDVFEFSQLL MDSGLMMDDS

     301  VTWITYHAAY DLGFLINILM NDSMPNNKED FEWWVHQYMP NFYDLNLVYK

     351  IIQEFKNPQL QQSSQQQQQQ QYSLTTLADE LGLPRFSIFT TTGGQSLLML

     401  LSFCQLSKLS MHKFPNGTDF AKYQGVIYGI DGDQ*

Protein Sequence for YNR052C_VL3 from AWRI:

YNR052C_VL3 [source=AWRI]  Length: 368  Thu Sep 21 07:53:58 2017  Type: P  Check: 3361  ..

       1  MPIFLKQKNE PLLTQQQQQQ QQQQQPFNIG TPVSVASLPP GLNVLQQQQQ

      51  QQQQQQQQQQ GVGLNRPLAS QLPKHLTNQS MPPIFLPPPN YLFVRDVWKS

     101  NLYSEFAVIR QLVSQYNHVS ISTEFVGTLA RPIGTFRSKV DYHYQTMRAN

     151  VDFLNPIQLG LSLSDANGNK PDNGPSTWQF NFEFDPKKEI MSTESLELLR

     201  KSGINFEKHE NLGIDVFEFS QLLMDSGLMM DDSVTWITYH AAYDLGFLIN

     251  ILMNDSMPNN KEDFEWWVHQ YMPNFYDLNL VYKIIQEFKN PQLQQSSQQQ

     301  QQQQYSLTTL ADELGLPRFS IFTTTGGQSL LMLLSFCQLS KLSMHKFPNG

     351  TDFAKYQGVI YGIDGDQ*

Protein Sequence for YNR052C_Vin13 from AWRI:

YNR052C_Vin13 [source=AWRI]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_W303 from Stanford:

YNR052C_W303 [source=Stanford]  Length: 429  Thu Sep 21 07:53:58 2017  Type: P  Check: 9937  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QGVGLNRPLA SQLPKHLTNQ SMPPIFLPPP

     151  NYLFVRDVWK SNLYSEFAVI RQLVSQYNHV SISTEFVGTL ARPIGTFRSK

     201  VDYHYQTMRA NVDFLNPIQL GLSLSDANGN KPDNGPSTWQ FNFEFDPKKE

     251  IMSTESLELL RKSGINFEKH ENLGIDVFEF SQLLMDSGLM MDDSVTWITY

     301  HAAYDLGFLI NILMNDSMPN NKEDFEWWVH QYMPNFYDLN LVYKIIQEFK

     351  NPQLQQSSQQ QQQQQYSLTT LADELGLPRF SIFTTTGGQS LLMLLSFCQL

     401  SKLSMHKFPN GTDFAKYQGV IYGIDGDQ*

Protein Sequence for YNR052C_X2180-1A from Stanford:

YNR052C_X2180-1A [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_Y55 from Stanford:

YNR052C_Y55 [source=Stanford]  Length: 448  Thu Sep 21 07:53:58 2017  Type: P  Check: 2489  ..

       1  MNVQPRVLAV GGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQQQQ PFNIGTPVSV ASLPPGLNVL QQQQQQQQQQ GVGLNRPLAS

     151  QLPKHLTNQS MPPIFLPPPN YLFVRDVWKS NLYSEFAVIR QLVSQYNHVS

     201  ISTEFVGTLA RPIGTFRSKV DYHYQTMRAN VDFLNPIQLG LSLSDANGNK

     251  PDNGPSTWQF NFEFDPKKEI MSTESLELLR KSGINFEKHE NSGIDVFEFS

     301  QLLMDSGLMM DDSVTWITYH AAYDLGFLIN ILMNDSMPNN KEDFEWWVHQ

     351  YMPNFYDLNL VYKIIQEFKN PQLQQSSQQQ QQQQYSLTTL ADELGLPRFS

     401  IFTTTGGQSL LMLLSFCQLS KLSMHKFPNG TDFAKYQGVI YGIDGDQ*


Protein Sequence for YNR052C_YJM269 from WashU:

YNR052C_YJM269 [source=WashU]  Length: 449  Thu Sep 21 07:53:58 2017  Type: P  Check: 6773  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP QVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQQQQ QPFNIGTPVS VASLPPGLNV LQQQQQQQQQ QGVGLNRPLA

     151  SQLPKHLTNQ SMPPIFLPPP NYLFVRDVWK SNLYSEFAVI RQLVSQYNHV

     201  SISTEFVGTL ARPIGTFRSK VDYHYQTMRA NVDFLNPIQL GLSLSDANGN

     251  KPDNGPSTWQ FNFEFDPKKE IMSTESLELL RKSGINFEKH ENSGIDVFEF

     301  SQLLMDSGLM MDDSVTWITY HAAYDLGFLI NILMNDSMPN NKEDFEWWVH

     351  QYMPNFYDLN LVYKIIQEFK NPQLQQSSQQ QQQQQYSLNT LADELGLPRF

     401  SIFTTTGGQS LLMLLSFCQL SKLSMHKFPN GTDFAKYQGV IYGIDGNQ*


Protein Sequence for YNR052C_YJM339 from Stanford:

YNR052C_YJM339 [source=Stanford]  Length: 445  Thu Sep 21 07:53:58 2017  Type: P  Check: 8227  ..

       1  MNVQPRVLAV GGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQPFN IGTPVSVASL PPGLNVLQQQ QQQQQQQGVG LNRPLASQLP

     151  KHLTNQSMPP IFLPPPNYLF VRDVWKSNLY SEFAVIRQLV SQYNHVSIST

     201  EFVGTLARPI GTFRSKVDYH YQTMRANVDF LNPIQLGLSL SDANGNKPDN

     251  GPSTWQFNFE FDPKKEIMST ESLELLRKSG INFEKHENSG IDVFEFSQLL

     301  MDSGLMMDDS VTWITYHAAY DLGFLINILM NDSMPNNKED FEWWVHQYMP

     351  NFYDLNLVYK IIQEFKNPQL QQSSQQQQQQ QYSLTTLADE LGLPRFSIFT

     401  TTGGQSLLML LSFCQLSKLS MHKFPNGTDF AKYQGVIYGI DGDQ*


Protein Sequence for YNR052C_YJM789 from Stanford:

YNR052C_YJM789 [source=Stanford]  Length: 445  Thu Sep 21 07:53:58 2017  Type: P  Check: 8305  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP QVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QQQQQQQQQQ

     101  QQPFNIGTPV SVASLPPGLN VLQQQQQQQQ QQQQQQQGVG LNRPLASQLP

     151  KHLTNQSMPP IFLPPPNYLF VRDVWKSNLY SEFAVIRQLV SQYNHVSIST

     201  EFVGTLARPI GTFRSKVDYH YQTMRANVDF LNPIQLGLSL SDANGNKPDN

     251  GPSTWQFNFE FDPKKEIMST ESLELLRKSG INFEKHENLG IDVFEFSQLL

     301  MDSGLMMDDS VTWITYHAAY DLGFLINILM NDSMPNNKED FEWWVHQYMP

     351  NFYDLNLVYK IIQEFKNPQL QQSSQQQQQQ QYSLTTLADE LGLPRFSIFT

     401  TTGGQSLLML LSFCQLSKLS MHKFPNGTDF AKYQGVIYGI DGDQ*


Protein Sequence for YNR052C_YPH499 from Stanford:

YNR052C_YPH499 [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4087  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENLGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_YPS128 from Stanford:

YNR052C_YPS128 [source=Stanford]  Length: 437  Thu Sep 21 07:53:58 2017  Type: P  Check: 4456  ..

       1  MNVQPRVLAV GGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQQQP

     101  FNIGTPVSVA SLPPGLNVLQ QQQQQQQQQG VGLNRPLASQ LPKHLTNQSM

     151  PPIFLPPPNY LFVRDVWKSN LYSEFAVIRQ LVSQYNHVSI STEFVGTLAR

     201  PIGTFRSKVD YHYQTMRANV DFLNPIQLGL SLSDANGNKP DNGPSTWQFN

     251  FEFDPKKEIM STESLELLRK SGINFEKHEN SGIDVFEFSQ LLMDSGLMMD

     301  DSVTWITYHA AYDLGFLINI LMNDSMPNNK EDFEWWVHQY MPNFYDLNLV

     351  YKIIQEFKNP QLQQSSQQQQ QQQYSLTTLA DELGLPRFSI FTTTGGQSLL

     401  MLLSFCQLSK LSMHKFPNGT DFAKYQGVIY GIDGDQ*

Protein Sequence for YNR052C_YPS163 from Stanford:

YNR052C_YPS163 [source=Stanford]  Length: 437  Thu Sep 21 07:53:58 2017  Type: P  Check: 4456  ..

       1  MNVQPRVLAV GGEQFFSQRQ ASEQHQQQNM GPQVYSPQVN RARMFPQGMP

      51  VNTINGSVNQ EMNNAYLLKQ KNEPLLTQQQ QQQQQQQQQQ QQQQQQQQQP

     101  FNIGTPVSVA SLPPGLNVLQ QQQQQQQQQG VGLNRPLASQ LPKHLTNQSM

     151  PPIFLPPPNY LFVRDVWKSN LYSEFAVIRQ LVSQYNHVSI STEFVGTLAR

     201  PIGTFRSKVD YHYQTMRANV DFLNPIQLGL SLSDANGNKP DNGPSTWQFN

     251  FEFDPKKEIM STESLELLRK SGINFEKHEN SGIDVFEFSQ LLMDSGLMMD

     301  DSVTWITYHA AYDLGFLINI LMNDSMPNNK EDFEWWVHQY MPNFYDLNLV

     351  YKIIQEFKNP QLQQSSQQQQ QQQYSLTTLA DELGLPRFSI FTTTGGQSLL

     401  MLLSFCQLSK LSMHKFPNGT DFAKYQGVIY GIDGDQ*

Protein Sequence for YNR052C_YS9 from Stanford:

YNR052C_YS9 [source=Stanford]  Length: 434  Thu Sep 21 07:53:58 2017  Type: P  Check: 4695  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP KVTRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QPFNIGTPVS

     101  VASLPPGLNV LQQQQQQQQQ QQQQQQGVGL NRPLASQLPK HLTNQSMPPI

     151  FLPPPNYLFV RDVWKSNLYS EFAVIRQLVS QYNHVSISTE FVGTLARPIG

     201  TFRSKVDYHY QTMRANVDFL NPIQLGLSLS DANGNKPDNG PSTWQFNFEF

     251  DPKKEIMSTE SLELLRKSGI NFEKHENSGI DVFEFSQLLM DSGLMMDDSV

     301  TWITYHAAYD LGFLINILMN DSMPNNKEDF EWWVHQYMPN FYDLNLVYKI

     351  IQEFKNPQLQ QSSQQQQQQQ YSLTTLADEL GLPRFSIFTT TGGQSLLMLL

     401  SFCQLSKLSM HKFPNGTDFA KYQGVIYGID GDQ*

Protein Sequence for YNR052C_ZTW1 from Zhejiang:

YNR052C_ZTW1 [source=Zhejiang]  Length: 445  Thu Sep 21 07:53:58 2017  Type: P  Check: 8157  ..

       1  MQSMNVQPRV LAVGGEQFFS QRQASEQHQQ QNMGPQVYSP QVNRARMFPQ

      51  GMPVNTINGS VNQEMNNAYL LKQKNEPLLT QQQQQQQQQQ QQQQQQQQQQ

     101  QQQQQQQPFN IGTPVSVASL PPGLNVLQQQ QQQQQQQGVG LNRPLASQLP

     151  KHLTNQSMPP IFLPPPNYLF VRDVWKSNLY SEFAVIRQLV SQYNHVSIST

     201  EFVGTLARPI GTFRSKVDYH YQTMRANVDF LNPIQLGLSL SDANGNKPDN

     251  GPSTWQFNFE FDPKKEIMST ESLELLRKSG INFEKHENSG IDVFEFSQLL

     301  MDSGLMMDDS VTWITYHAAY DLGFLINILM NDSMPNNKED FEWWVHQYMP

     351  NFYDLNLVYK IIQEFKNPQL QQSSQQQQQQ QYSLTTLADE LGLPRFSIFT

     401  TTGGQSLLML LSFCQLSKLS MHKFPNGTDF AKYQGVIYGI DGDQ*