YNL339W-B S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YNL339W-B_S288C   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
YNL339W-B_AWRI796   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
YNL339W-B_CLIB215   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFLALF   50
YNL339W-B_CLIB324   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDPYRLLPPILPGTF   50
YNL339W-B_CLIB382   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
YNL339W-B_EC1118   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
YNL339W-B_JAY291   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
YNL339W-B_LalvinQA23   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFSRALPQRPYRLLPPILPGTF   50
YNL339W-B_M22   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
YNL339W-B_T73   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
YNL339W-B_VL3   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
YNL339W-B_Vin13   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPXLF   50
YNL339W-B_YJM789   1   MMPAKLQLDVLRTLQSSARHGTQTLKNSNFLERFHKDRIVFCLPFFPALF   50
         

YNL339W-B_S288C   51   FVPVQKVLQHLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
YNL339W-B_AWRI796   51   XVPVQKVLQHLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
YNL339W-B_CLIB215   51   LVPVQKVLQYLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
YNL339W-B_CLIB324   51   SRPSSK---------STAAPLSSIHASCSILYNTTL--------------   77
YNL339W-B_CLIB382   51   FVPVQKVLQHLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
YNL339W-B_EC1118   51   LVPVQKVLQHLCLRFTQVAPYFIIKTL-----------------------   77
YNL339W-B_JAY291   51   LVPVQKVLQHLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
YNL339W-B_LalvinQA23   51   SRPSSK---------STAAPLSSIHASCSILYNXDSLICLPDMRKTWLPC   91
YNL339W-B_M22   51   LVPVQKVLQYLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
YNL339W-B_T73   51   LVPVQKVLQHLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
YNL339W-B_VL3   51   LVPVQKVLQHLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
YNL339W-B_Vin13   51   LVPVQKVLQHLCLRFTQVAPYFIIKTL-----------------------   77
YNL339W-B_YJM789   51   FVPVQKVLQHLCLRFTQVAPYFIIQLFDLPSRHAENLAPLLASCRIQYTN   100
         

YNL339W-B_S288C   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKKFQIPYRVPMIWLDVFQVFFVF   150
YNL339W-B_AWRI796   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKKFQIPYRVPMIWLDVFQVFFVF   150
YNL339W-B_CLIB215   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKKFQIPYRVPMIWLDVFQVFFVF   150
YNL339W-B_CLIB324   
   --------------------------------------------------   
YNL339W-B_CLIB382   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKNFKYPTGSP-------------   137
YNL339W-B_EC1118   
   --------------------------------------------------   
YNL339W-B_JAY291   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKKFQIPYRVPMIWLDVFQVFFVF   150
YNL339W-B_LalvinQA23   92   LPLVESNTLIVSLLLVMARYQA----------------------------   113
YNL339W-B_M22   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKKFQIPYRVPMIWLDVFQVFFVF   150
YNL339W-B_T73   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKKFQIPYRVPMIWLDVFQVFFVF   150
YNL339W-B_VL3   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKIFQIXYRVPMIWLDVFQVFFVF   150
YNL339W-B_Vin13   
   --------------------------------------------------   
YNL339W-B_YJM789   101   CFSSSSNGQVPSIISLYLRVDLSPFYAKIFQISYRVPMIWLDVFQVFFVF   150
         

YNL339W-B_S288C   151   LVISQHSLHS   160
YNL339W-B_AWRI796   151   LVISQHSLHS   160
YNL339W-B_CLIB215   151   LVISQHSLHS   160
YNL339W-B_CLIB324   
   ----------   
YNL339W-B_CLIB382   
   ----------   
YNL339W-B_EC1118   
   ----------   
YNL339W-B_JAY291   151   LVISQHSLHS   160
YNL339W-B_LalvinQA23   
   ----------   
YNL339W-B_M22   151   LVISQHSLHS   160
YNL339W-B_T73   151   LVISQHSLHS   160
YNL339W-B_VL3   151   LVISQHSLHS   160
YNL339W-B_Vin13   
   ----------   
YNL339W-B_YJM789   151   LVISQHSLHS   160
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YNL339W-B_S288C from SGD:

YNL339W-B_S288C [source=SGD]  Length: 161  Thu Sep 21 09:24:01 2017  Type: P  Check: 217  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  FVPVQKVLQH LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKKF QIPYRVPMIW LDVFQVFFVF

     151  LVISQHSLHS *

Protein Sequence for YNL339W-B_AWRI796 from AWRI:

YNL339W-B_AWRI796 [source=AWRI]  Length: 161  Thu Sep 21 09:24:01 2017  Type: P  Check: 1135  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  XVPVQKVLQH LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKKF QIPYRVPMIW LDVFQVFFVF

     151  LVISQHSLHS *

Protein Sequence for YNL339W-B_CLIB215 from WashU:

YNL339W-B_CLIB215 [source=WashU]  Length: 161  Thu Sep 21 09:24:01 2017  Type: P  Check: 386  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFLALF

      51  LVPVQKVLQY LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKKF QIPYRVPMIW LDVFQVFFVF

     151  LVISQHSLHS *

Protein Sequence for YNL339W-B_CLIB324 from WashU:

YNL339W-B_CLIB324 [source=WashU]  Length: 78  Thu Sep 21 09:24:01 2017  Type: P  Check: 6180  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDPYR LLPPILPGTF

      51  SRPSSKSTAA PLSSIHASCS ILYNTTL*

Protein Sequence for YNL339W-B_CLIB382 from WashU:

YNL339W-B_CLIB382 [source=WashU]  Length: 138  Thu Sep 21 09:24:01 2017  Type: P  Check: 6554  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  FVPVQKVLQH LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKNF KYPTGSP*

Protein Sequence for YNL339W-B_EC1118 from Genoscope:

YNL339W-B_EC1118 [source=Genoscope]  Length: 78  Thu Sep 21 09:24:01 2017  Type: P  Check: 3759  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  LVPVQKVLQH LCLRFTQVAP YFIIKTL*

Protein Sequence for YNL339W-B_JAY291 from Duke:

YNL339W-B_JAY291 [source=Duke]  Length: 161  Thu Sep 21 09:24:01 2017  Type: P  Check: 523  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  LVPVQKVLQH LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKKF QIPYRVPMIW LDVFQVFFVF

     151  LVISQHSLHS *

Protein Sequence for YNL339W-B_LalvinQA23 from AWRI:

YNL339W-B_LalvinQA23 [source=AWRI]  Length: 114  Thu Sep 21 09:24:01 2017  Type: P  Check: 6665  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF SRALPQRPYR LLPPILPGTF

      51  SRPSSKSTAA PLSSIHASCS ILYNXDSLIC LPDMRKTWLP CLPLVESNTL

     101  IVSLLLVMAR YQA*

Protein Sequence for YNL339W-B_M22 from WashU:

YNL339W-B_M22 [source=WashU]  Length: 161  Thu Sep 21 09:24:01 2017  Type: P  Check: 574  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  LVPVQKVLQY LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKKF QIPYRVPMIW LDVFQVFFVF

     151  LVISQHSLHS *

Protein Sequence for YNL339W-B_T73 from WashU:

YNL339W-B_T73 [source=WashU]  Length: 161  Thu Sep 21 09:24:01 2017  Type: P  Check: 523  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  LVPVQKVLQH LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKKF QIPYRVPMIW LDVFQVFFVF

     151  LVISQHSLHS *

Protein Sequence for YNL339W-B_VL3 from AWRI:

YNL339W-B_VL3 [source=AWRI]  Length: 161  Thu Sep 21 09:24:01 2017  Type: P  Check: 645  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  LVPVQKVLQH LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKIF QIXYRVPMIW LDVFQVFFVF

     151  LVISQHSLHS *

Protein Sequence for YNL339W-B_Vin13 from AWRI:

YNL339W-B_Vin13 [source=AWRI]  Length: 78  Thu Sep 21 09:24:01 2017  Type: P  Check: 4863  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPXLF

      51  LVPVQKVLQH LCLRFTQVAP YFIIKTL*

Protein Sequence for YNL339W-B_YJM789 from Stanford:

YNL339W-B_YJM789 [source=Stanford]  Length: 161  Thu Sep 21 09:24:01 2017  Type: P  Check: 244  ..

       1  MMPAKLQLDV LRTLQSSARH GTQTLKNSNF LERFHKDRIV FCLPFFPALF

      51  FVPVQKVLQH LCLRFTQVAP YFIIQLFDLP SRHAENLAPL LASCRIQYTN

     101  CFSSSSNGQV PSIISLYLRV DLSPFYAKIF QISYRVPMIW LDVFQVFFVF

     151  LVISQHSLHS *