MET2/YNL277W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YNL277W_S288C   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_AWRI796   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_BC187   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_BY4741   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_BY4742   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_CBS7960   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_CEN.PK   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_CLIB215   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_CLIB324   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_D273-10B   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_DBVPG6044   1   MSHTLKSKTLQELDIEEIKESNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_EC1118   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_EC9-8   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_FL100   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_FY1679   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_FostersB   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_FostersO   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_JAY291   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_JK9-3d   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_K11   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_Kyokai7   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_L1528   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_LalvinQA23   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_M22   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_PW5   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_RM11-1a   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_RedStar   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_SEY6210   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_SK1   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_T7   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_T73   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_UC5   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_VL3   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_Vin13   
   --------------------------------------------------   
YNL277W_W303   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_X2180-1A   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_Y55   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_YJM269   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_YJM789   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_YPH499   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_YPS128   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_YPS163   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_YS9   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
YNL277W_ZTW1   1   MSHTLKSKTLQELDIEEIKETNPLLKLVQGQRIVQVPELVLESGVVINNF   50
         

YNL277W_S288C   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_AWRI796   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_BC187   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_BY4741   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_BY4742   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_CBS7960   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_CEN.PK   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_CLIB215   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_CLIB324   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_D273-10B   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_DBVPG6044   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_EC1118   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_EC9-8   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_FL100   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_FY1679   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_FostersB   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_FostersO   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_JAY291   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_JK9-3d   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_K11   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_Kyokai7   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_L1528   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_LalvinQA23   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_M22   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_PW5   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_RM11-1a   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_RedStar   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_SEY6210   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_SK1   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_T7   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_T73   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_UC5   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_VL3   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_Vin13   
   --------------------------------------------------   
YNL277W_W303   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_X2180-1A   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_Y55   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_YJM269   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_YJM789   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_YPH499   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_YPS128   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_YPS163   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_YS9   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
YNL277W_ZTW1   51   PIAYKTWGTLNEAGDNVLVICHALTGSADVADWWGPLLGNDLAFDPSRFF   100
         

YNL277W_S288C   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_AWRI796   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_BC187   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_BY4741   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_BY4742   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_CBS7960   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_CEN.PK   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_CLIB215   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_CLIB324   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_D273-10B   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_DBVPG6044   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_EC1118   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_EC9-8   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_FL100   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_FY1679   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_FostersB   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_FostersO   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_JAY291   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_JK9-3d   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_K11   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_Kyokai7   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_L1528   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_LalvinQA23   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_M22   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_PW5   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_RM11-1a   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_RedStar   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_SEY6210   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_SK1   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_T7   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_T73   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_UC5   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_VL3   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_Vin13   
   --------------------------------------------------   
YNL277W_W303   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_X2180-1A   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_Y55   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_YJM269   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_YJM789   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_YPH499   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_YPS128   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_YPS163   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_YS9   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
YNL277W_ZTW1   101   IICLNSMGSPYGSFSPLTINEETGVRYGPEFPLCTVRDDVRAHRIVLDSL   150
         

YNL277W_S288C   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_AWRI796   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_BC187   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_BY4741   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_BY4742   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_CBS7960   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_CEN.PK   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_CLIB215   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_CLIB324   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_D273-10B   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_DBVPG6044   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVSLATSARHSAWCISWS   200
YNL277W_EC1118   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_EC9-8   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_FL100   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_FY1679   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_FostersB   151   GVKSIACVIGGSMXGMXSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_FostersO   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_JAY291   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_JK9-3d   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_K11   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_Kyokai7   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_L1528   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_LalvinQA23   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_M22   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_PW5   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_RM11-1a   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_RedStar   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_SEY6210   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_SK1   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_T7   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_T73   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_UC5   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_VL3   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_Vin13   1   ---------------MLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   35
YNL277W_W303   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_X2180-1A   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_Y55   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_YJM269   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_YJM789   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_YPH499   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_YPS128   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_YPS163   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_YS9   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
YNL277W_ZTW1   151   GVKSIACVIGGSMGGMLSLEWAAMYGKEYVKNMVALATSARHSAWCISWS   200
         

YNL277W_S288C   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_AWRI796   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_BC187   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_BY4741   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_BY4742   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_CBS7960   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_CEN.PK   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_CLIB215   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_CLIB324   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_D273-10B   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_DBVPG6044   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_EC1118   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNIFENKFS   250
YNL277W_EC9-8   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_FL100   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_FY1679   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_FostersB   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_FostersO   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_JAY291   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_JK9-3d   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_K11   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_Kyokai7   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_L1528   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_LalvinQA23   201   EXQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNXFENKFS   250
YNL277W_M22   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_PW5   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_RM11-1a   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_RedStar   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_SEY6210   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_SK1   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_T7   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_T73   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_UC5   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_VL3   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_Vin13   36   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   85
YNL277W_W303   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_X2180-1A   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_Y55   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_YJM269   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_YJM789   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_YPH499   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_YPS128   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_YPS163   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_YS9   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
YNL277W_ZTW1   201   EAQRQSIYSDPNYLDGYYPVEEQPVAGLSAARMSALLTYRTRNSFENKFS   250
         

YNL277W_S288C   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_AWRI796   251   RRSPSIAQQQKX--------------------------------------   262
YNL277W_BC187   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_BY4741   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_BY4742   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_CBS7960   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_CEN.PK   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_CLIB215   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_CLIB324   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_D273-10B   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_DBVPG6044   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_EC1118   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_EC9-8   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_FL100   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_FY1679   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_FostersB   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_FostersO   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_JAY291   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_JK9-3d   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_K11   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_Kyokai7   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_L1528   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_LalvinQA23   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_M22   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_PW5   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_RM11-1a   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_RedStar   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_SEY6210   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_SK1   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_T7   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_T73   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_UC5   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_VL3   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_Vin13   86   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   135
YNL277W_W303   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_X2180-1A   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_Y55   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_YJM269   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_YJM789   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_YPH499   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_YPS128   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_YPS163   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_YS9   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
YNL277W_ZTW1   251   RRSPSIAQQQKAQREETRKPSTVSEHSLQIHNDGYKTKASTAIAGISGQK   300
         

YNL277W_S288C   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_AWRI796   263   ------------------------SKGGDTQTIYCQRTLPTNPQ------   282
YNL277W_BC187   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_BY4741   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_BY4742   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_CBS7960   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_CEN.PK   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_CLIB215   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_CLIB324   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_D273-10B   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_DBVPG6044   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_EC1118   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_EC9-8   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_FL100   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_FY1679   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_FostersB   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_FostersO   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_JAY291   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_JK9-3d   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_K11   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_Kyokai7   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_L1528   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_LalvinQA23   301   XQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_M22   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_PW5   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_RM11-1a   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_RedStar   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_SEY6210   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_SK1   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_T7   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_T73   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_UC5   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_VL3   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_Vin13   136   XQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   185
YNL277W_W303   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_X2180-1A   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_Y55   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_YJM269   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_YJM789   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_YPH499   301   GQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_YPS128   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_YPS163   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_YS9   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
YNL277W_ZTW1   301   RQSVVSTASSSDSLNSSTSMTSVSSVTGEVKDIKPAQTYFSAQSYLRYQG   350
         

YNL277W_S288C   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_AWRI796   
   --------------------------------------------------   
YNL277W_BC187   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_BY4741   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_BY4742   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_CBS7960   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_CEN.PK   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_CLIB215   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_CLIB324   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_D273-10B   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_DBVPG6044   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_EC1118   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_EC9-8   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_FL100   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_FY1679   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_FostersB   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_FostersO   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_JAY291   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_JK9-3d   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_K11   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_Kyokai7   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_L1528   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_LalvinQA23   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_M22   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_PW5   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_RM11-1a   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_RedStar   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_SEY6210   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_SK1   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_T7   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_T73   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_UC5   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_VL3   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_Vin13   186   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   235
YNL277W_W303   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_X2180-1A   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_Y55   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_YJM269   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQQSLIIGIQS   400
YNL277W_YJM789   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_YPH499   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_YPS128   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_YPS163   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_YS9   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
YNL277W_ZTW1   351   TKFINRFDANCYIAITRKLDTHDLARDRVDDITEVLSTIQQPSLIIGIQS   400
         

YNL277W_S288C   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_AWRI796   
   --------------------------------------------------   
YNL277W_BC187   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_BY4741   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_BY4742   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_CBS7960   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_CEN.PK   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_CLIB215   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_CLIB324   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_D273-10B   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_DBVPG6044   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_EC1118   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_EC9-8   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_FL100   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_FY1679   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_FostersB   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_FostersO   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_JAY291   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_JK9-3d   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_K11   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_Kyokai7   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_L1528   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_LalvinQA23   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_M22   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_PW5   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_RM11-1a   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_RedStar   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_SEY6210   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_SK1   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_T7   401   DGLFTYSEQEFLAEHIPKSRLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_T73   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_UC5   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_VL3   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_Vin13   236   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   285
YNL277W_W303   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_X2180-1A   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_Y55   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_YJM269   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_YJM789   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_YPH499   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_YPS128   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_YPS163   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_YS9   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
YNL277W_ZTW1   401   DGLFTYSEQEFLAEHIPKSQLEKIESPEGHDAFLLEFKLINKLIVQFLKT   450
         

YNL277W_S288C   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_AWRI796   
   ------------------------------------   
YNL277W_BC187   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_BY4741   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_BY4742   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_CBS7960   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_CEN.PK   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_CLIB215   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_CLIB324   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_D273-10B   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_DBVPG6044   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_EC1118   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_EC9-8   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_FL100   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_FY1679   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_FostersB   451   NCKAITDAAPRAWGXDVGNDETKTSVFGEAEEVTNW   486
YNL277W_FostersO   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_JAY291   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_JK9-3d   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_K11   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_Kyokai7   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_L1528   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_LalvinQA23   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_M22   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_PW5   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_RM11-1a   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_RedStar   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_SEY6210   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_SK1   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_T7   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_T73   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_UC5   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_VL3   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_Vin13   286   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   321
YNL277W_W303   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_X2180-1A   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_Y55   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_YJM269   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_YJM789   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_YPH499   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_YPS128   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_YPS163   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_YS9   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
YNL277W_ZTW1   451   NCKAITDAAPRAWGGDVGNDETKTSVFGEAEEVTNW   486
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YNL277W_S288C from SGD:

YNL277W_S288C [source=SGD]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_AWRI796 from AWRI:

YNL277W_AWRI796 [source=AWRI]  Length: 283  Fri Jul 20 11:21:58 2018  Type: P  Check: 7152  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KXSKGGDTQT IYCQRTLPTN PQ*

Protein Sequence for YNL277W_BC187 from Stanford:

YNL277W_BC187 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_BY4741 from Stanford:

YNL277W_BY4741 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_BY4742 from Stanford:

YNL277W_BY4742 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_CBS7960 from WashU:

YNL277W_CBS7960 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_CEN.PK from Stanford:

YNL277W_CEN.PK [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_CLIB215 from WashU:

YNL277W_CLIB215 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_CLIB324 from WashU:

YNL277W_CLIB324 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_D273-10B from Stanford:

YNL277W_D273-10B [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_DBVPG6044 from Stanford:

YNL277W_DBVPG6044 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2425  ..

       1  MSHTLKSKTL QELDIEEIKE SNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVSLATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_EC1118 from Genoscope:

YNL277W_EC1118 [source=Genoscope]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 1858  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNIFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_EC9-8 from ASinica:

YNL277W_EC9-8 [source=ASinica]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_FL100 from Stanford:

YNL277W_FL100 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_FY1679 from Stanford:

YNL277W_FY1679 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_FostersB from AWRI:

YNL277W_FostersB [source=AWRI]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 3833  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMXGMXSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGXDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_FostersO from AWRI:

YNL277W_FostersO [source=AWRI]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_JAY291 from Duke:

YNL277W_JAY291 [source=Duke]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_JK9-3d from Stanford:

YNL277W_JK9-3d [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_K11 from Stanford:

YNL277W_K11 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_Kyokai7 from NRIB:

YNL277W_Kyokai7 [source=NRIB]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_L1528 from Stanford:

YNL277W_L1528 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_LalvinQA23 from AWRI:

YNL277W_LalvinQA23 [source=AWRI]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 3083  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EXQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNXFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  XQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_M22 from WashU:

YNL277W_M22 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_PW5 from WashU:

YNL277W_PW5 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_RM11-1a from Stanford:

YNL277W_RM11-1a [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_RedStar from Stanford:

YNL277W_RedStar [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_SEY6210 from Stanford:

YNL277W_SEY6210 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_SK1 from Stanford:

YNL277W_SK1 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_T7 from WashU:

YNL277W_T7 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2215  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSR LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_T73 from WashU:

YNL277W_T73 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_UC5 from WashU:

YNL277W_UC5 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_VL3 from AWRI:

YNL277W_VL3 [source=AWRI]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_Vin13 from AWRI:

YNL277W_Vin13 [source=AWRI]  Length: 322  Fri Jul 20 11:21:58 2018  Type: P  Check: 137  ..

       1  MLSLEWAAMY GKEYVKNMVA LATSARHSAW CISWSEAQRQ SIYSDPNYLD

      51  GYYPVEEQPV AGLSAARMSA LLTYRTRNSF ENKFSRRSPS IAQQQKAQRE

     101  ETRKPSTVSE HSLQIHNDGY KTKASTAIAG ISGQKXQSVV STASSSDSLN

     151  SSTSMTSVSS VTGEVKDIKP AQTYFSAQSY LRYQGTKFIN RFDANCYIAI

     201  TRKLDTHDLA RDRVDDITEV LSTIQQPSLI IGIQSDGLFT YSEQEFLAEH

     251  IPKSQLEKIE SPEGHDAFLL EFKLINKLIV QFLKTNCKAI TDAAPRAWGG

     301  DVGNDETKTS VFGEAEEVTN W*

Protein Sequence for YNL277W_W303 from Stanford:

YNL277W_W303 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_X2180-1A from Stanford:

YNL277W_X2180-1A [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_Y55 from Stanford:

YNL277W_Y55 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_YJM269 from WashU:

YNL277W_YJM269 [source=WashU]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2244  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QQSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_YJM789 from Stanford:

YNL277W_YJM789 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_YPH499 from Stanford:

YNL277W_YPH499 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2018  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  GQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_YPS128 from Stanford:

YNL277W_YPS128 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_YPS163 from Stanford:

YNL277W_YPS163 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_YS9 from Stanford:

YNL277W_YS9 [source=Stanford]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*

Protein Sequence for YNL277W_ZTW1 from Zhejiang:

YNL277W_ZTW1 [source=Zhejiang]  Length: 487  Fri Jul 20 11:21:58 2018  Type: P  Check: 2194  ..

       1  MSHTLKSKTL QELDIEEIKE TNPLLKLVQG QRIVQVPELV LESGVVINNF

      51  PIAYKTWGTL NEAGDNVLVI CHALTGSADV ADWWGPLLGN DLAFDPSRFF

     101  IICLNSMGSP YGSFSPLTIN EETGVRYGPE FPLCTVRDDV RAHRIVLDSL

     151  GVKSIACVIG GSMGGMLSLE WAAMYGKEYV KNMVALATSA RHSAWCISWS

     201  EAQRQSIYSD PNYLDGYYPV EEQPVAGLSA ARMSALLTYR TRNSFENKFS

     251  RRSPSIAQQQ KAQREETRKP STVSEHSLQI HNDGYKTKAS TAIAGISGQK

     301  RQSVVSTASS SDSLNSSTSM TSVSSVTGEV KDIKPAQTYF SAQSYLRYQG

     351  TKFINRFDAN CYIAITRKLD THDLARDRVD DITEVLSTIQ QPSLIIGIQS

     401  DGLFTYSEQE FLAEHIPKSQ LEKIESPEGH DAFLLEFKLI NKLIVQFLKT

     451  NCKAITDAAP RAWGGDVGND ETKTSVFGEA EEVTNW*