ALP1/YNL270C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YNL270C_S288C   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_AWRI796   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_BC187   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_BY4741   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_BY4742   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_CBS7960   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_CEN.PK   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_CLIB215   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_CLIB324   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_DBVPG6044   1   MDETVNLQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_EC1118   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_EC9-8   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_FostersB   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_FostersO   
   --------------------------------------------------   
YNL270C_JAY291   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_K11   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_Kyokai7   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_L1528   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_LalvinQA23   
   --------------------------------------------------   
YNL270C_SEY6210   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_T7   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_UC5   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_UWOPS05_217_3   1   -MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVE   49
YNL270C_VL3   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_Vin13   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_W303   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_Y10   1   -MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVE   49
YNL270C_Y55   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_YJM269   1   -MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVE   49
YNL270C_YJM789   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_YPH499   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_YPS128   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_YPS163   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_YS9   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
YNL270C_ZTW1   1   MDETVNIQMSKEGQYEINSSSIIKEEEFVDEQYSGENVTKAITTERKVED   50
         

YNL270C_S288C   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_AWRI796   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_BC187   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_BY4741   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_BY4742   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_CBS7960   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_CEN.PK   51   DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   100
YNL270C_CLIB215   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_CLIB324   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_DBVPG6044   51   D-AAKEAESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_EC1118   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_EC9-8   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_FostersB   51   DDAAKETESSPQERREVKRKLXQRHIGMIALGGTIXTGLIIGIGPPLAHA   100
YNL270C_FostersO   
   --------------------------------------------------   
YNL270C_JAY291   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_K11   51   DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   100
YNL270C_Kyokai7   51   DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   100
YNL270C_L1528   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_LalvinQA23   
   --------------------------------------------------   
YNL270C_SEY6210   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_T7   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_UC5   51   DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   100
YNL270C_UWOPS05_217_3   50   DDAAKETETSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_VL3   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_Vin13   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_W303   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_Y10   50   DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_Y55   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_YJM269   50   DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_YJM789   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_YPH499   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_YPS128   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_YPS163   51   D-AAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   99
YNL270C_YS9   51   DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   100
YNL270C_ZTW1   51   DDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHA   100
         

YNL270C_S288C   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_AWRI796   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_BC187   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_BY4741   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_BY4742   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_CBS7960   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_CEN.PK   101   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   150
YNL270C_CLIB215   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_CLIB324   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_DBVPG6044   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_EC1118   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_EC9-8   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_FostersB   101   GPVGALISYLFMGTVIYSVTQSLGEMATFIXVTSSFSVFAQRFLSPALGA   150
YNL270C_FostersO   1   -----------MGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   39
YNL270C_JAY291   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_K11   101   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   150
YNL270C_Kyokai7   101   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   150
YNL270C_L1528   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_LalvinQA23   
   --------------------------------------------------   
YNL270C_SEY6210   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_T7   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_UC5   101   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   150
YNL270C_UWOPS05_217_3   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_VL3   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_Vin13   100   GPVGALISYLFMGTVIYSVTQSLGEMXTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_W303   100   GPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_Y10   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_Y55   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_YJM269   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_YJM789   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_YPH499   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_YPS128   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_YPS163   100   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   149
YNL270C_YS9   101   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   150
YNL270C_ZTW1   101   GPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGA   150
         

YNL270C_S288C   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_AWRI796   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_BC187   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_BY4741   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_BY4742   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_CBS7960   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_CEN.PK   151   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   200
YNL270C_CLIB215   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_CLIB324   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_DBVPG6044   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEEVPLAAWIVIFWCLLTSMNM   199
YNL270C_EC1118   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_EC9-8   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_FostersB   151   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLXAWIVIFWCLLTSMNM   200
YNL270C_FostersO   40   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   89
YNL270C_JAY291   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_K11   151   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   200
YNL270C_Kyokai7   151   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   200
YNL270C_L1528   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_LalvinQA23   1   ----MYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   46
YNL270C_SEY6210   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_T7   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_UC5   151   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   200
YNL270C_UWOPS05_217_3   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_VL3   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_Vin13   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_W303   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_Y10   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_Y55   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_YJM269   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_YJM789   150   TNGYMYWLSWCFTFALELSVLGKVIQYWIQAVPLAAWIVIFWCLLTSMNM   199
YNL270C_YPH499   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_YPS128   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_YPS163   150   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   199
YNL270C_YS9   151   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   200
YNL270C_ZTW1   151   TNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNM   200
         

YNL270C_S288C   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_AWRI796   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFQVLEKS   249
YNL270C_BC187   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_BY4741   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_BY4742   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_CBS7960   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_CEN.PK   201   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   250
YNL270C_CLIB215   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_CLIB324   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_DBVPG6044   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_EC1118   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_EC9-8   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_FostersB   201   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   250
YNL270C_FostersO   90   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   139
YNL270C_JAY291   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_K11   201   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   250
YNL270C_Kyokai7   201   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   250
YNL270C_L1528   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_LalvinQA23   47   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   96
YNL270C_SEY6210   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_T7   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_UC5   201   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   250
YNL270C_UWOPS05_217_3   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQFDGPIGFRYWRNP   249
YNL270C_VL3   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_Vin13   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_W303   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_Y10   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_Y55   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_YJM269   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_YJM789   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_YPH499   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_YPS128   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_YPS163   200   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   249
YNL270C_YS9   201   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   250
YNL270C_ZTW1   201   FPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNP   250
         

YNL270C_S288C   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_AWRI796   250   RSLG----------------------------------------------   253
YNL270C_BC187   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_BY4741   250   GAWGXXXXXXXXXXXXXXXXXXXXXXXXAAFTYQGTELVGITAGEAANPR   299
YNL270C_BY4742   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_CBS7960   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_CEN.PK   251   GAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   300
YNL270C_CLIB215   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_CLIB324   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_DBVPG6044   250   GAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_EC1118   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_EC9-8   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_FostersB   251   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   300
YNL270C_FostersO   140   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   189
YNL270C_JAY291   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_K11   251   GAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   300
YNL270C_Kyokai7   251   GAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   300
YNL270C_L1528   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_LalvinQA23   97   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   146
YNL270C_SEY6210   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_T7   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_UC5   251   GAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   300
YNL270C_UWOPS05_217_3   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_VL3   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_Vin13   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_W303   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_Y10   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_Y55   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_YJM269   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_YJM789   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_YPH499   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_YPS128   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_YPS163   250   GAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   299
YNL270C_YS9   251   GAWGXXXXX-----------XXXXXXXXXXXXXXXXXXVGITAGEAANPR   289
YNL270C_ZTW1   251   GAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKA   300
         

YNL270C_S288C   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_AWRI796   254   ---------------------------------------GLALSPVIKMR   264
YNL270C_BC187   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_BY4741   300   KALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMI   349
YNL270C_BY4742   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_CBS7960   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_CEN.PK   301   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   350
YNL270C_CLIB215   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_CLIB324   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_DBVPG6044   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_EC1118   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_EC9-8   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_FostersB   301   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   350
YNL270C_FostersO   190   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   239
YNL270C_JAY291   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_K11   301   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   350
YNL270C_Kyokai7   301   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   350
YNL270C_L1528   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_LalvinQA23   147   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   196
YNL270C_SEY6210   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_T7   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_UC5   301   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   350
YNL270C_UWOPS05_217_3   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_VL3   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_Vin13   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_W303   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_Y10   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_Y55   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_YJM269   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_YJM789   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_YPH499   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_YPS128   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_YPS163   300   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   349
YNL270C_YS9   290   KALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMI   339
YNL270C_ZTW1   301   LPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISI   350
         

YNL270C_S288C   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_AWRI796   265   AVFSDGFPL-----------------------------------------   273
YNL270C_BC187   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_BY4741   350   SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL   399
YNL270C_BY4742   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_CBS7960   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_CEN.PK   351   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   400
YNL270C_CLIB215   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_CLIB324   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_DBVPG6044   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_EC1118   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_EC9-8   350   ENSGTKVLLDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_FostersB   351   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   400
YNL270C_FostersO   240   ENXGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   289
YNL270C_JAY291   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_K11   351   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   400
YNL270C_Kyokai7   351   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   400
YNL270C_L1528   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_LalvinQA23   197   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   246
YNL270C_SEY6210   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_T7   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSH   399
YNL270C_UC5   351   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   400
YNL270C_UWOPS05_217_3   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_VL3   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_Vin13   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_W303   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_Y10   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_Y55   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_YJM269   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_YJM789   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_YPH499   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_YPS128   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_YPS163   350   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   399
YNL270C_YS9   340   SIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFL   389
YNL270C_ZTW1   351   ENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSN   400
         

YNL270C_S288C   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_AWRI796   
   --------------------------------------------------   
YNL270C_BC187   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_BY4741   400   SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW   449
YNL270C_BY4742   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_CBS7960   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_CEN.PK   401   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   450
YNL270C_CLIB215   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_CLIB324   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_DBVPG6044   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_EC1118   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_EC9-8   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_FostersB   401   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKXFNWLLNITGVAGFFAWLL   450
YNL270C_FostersO   290   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   339
YNL270C_JAY291   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_K11   401   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   450
YNL270C_Kyokai7   401   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   450
YNL270C_L1528   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_LalvinQA23   247   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   296
YNL270C_SEY6210   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_T7   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_UC5   401   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   450
YNL270C_UWOPS05_217_3   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_VL3   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_Vin13   400   VTRGGVPYFSVLSTXVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_W303   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_Y10   400   VTRGGVPYFSVLSTSVFGFLALLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_Y55   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_YJM269   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_YJM789   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_YPH499   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_YPS128   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_YPS163   400   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   449
YNL270C_YS9   390   SNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAW   439
YNL270C_ZTW1   401   VTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLL   450
         

YNL270C_S288C   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_AWRI796   
   --------------------------------------------------   
YNL270C_BC187   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_BY4741   450   LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQG   499
YNL270C_BY4742   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_CBS7960   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_CEN.PK   451   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   500
YNL270C_CLIB215   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_CLIB324   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_DBVPG6044   450   ISFSHIRFMQAIRKRGISRDDFPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_EC1118   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_EC9-8   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_FostersB   451   ISXSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   500
YNL270C_FostersO   340   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFXGILCIFFHRSNCSDPGLH   389
YNL270C_JAY291   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_K11   451   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   500
YNL270C_Kyokai7   451   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   500
YNL270C_L1528   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_LalvinQA23   297   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   346
YNL270C_SEY6210   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_T7   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_UC5   451   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   500
YNL270C_UWOPS05_217_3   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYAFFFIALIVLIQGFT   499
YNL270C_VL3   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_Vin13   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_W303   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_Y10   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_Y55   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_YJM269   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_YJM789   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_YPH499   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_YPS128   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_YPS163   450   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   499
YNL270C_YS9   440   LLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQG   489
YNL270C_ZTW1   451   ISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFT   500
         

YNL270C_S288C   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_AWRI796   
   --------------------------------------------------   
YNL270C_BC187   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_BY4741   500   FTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSD   549
YNL270C_BY4742   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_CBS7960   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_CEN.PK   501   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDHR   550
YNL270C_CLIB215   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_CLIB324   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_DBVPG6044   500   AFAPTFHPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_EC1118   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_EC9-8   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_FostersB   501   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   550
YNL270C_FostersO   390   RFRTYFSAYRLCRCIYINIPIFGHMVIIPSLV------------------   421
YNL270C_JAY291   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_K11   501   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   550
YNL270C_Kyokai7   501   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   550
YNL270C_L1528   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_LalvinQA23   347   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   396
YNL270C_SEY6210   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_T7   500   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_UC5   501   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   550
YNL270C_UWOPS05_217_3   500   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLIWKLQDIDIDSDRR   549
YNL270C_VL3   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_Vin13   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_W303   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_Y10   500   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLIWKLQDIDIDSDRR   549
YNL270C_Y55   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_YJM269   500   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLIWKLQDIDIDSDRR   549
YNL270C_YJM789   500   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_YPH499   500   AFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_YPS128   500   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_YPS163   500   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   549
YNL270C_YS9   490   FTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSD   539
YNL270C_ZTW1   501   AFAPTFQPIDFVAAYISVFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR   550
         

YNL270C_S288C   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_AWRI796   
   --------------------------   
YNL270C_BC187   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_BY4741   550   RRQIEELVWIEPECKTRWQRVWDVLS   575
YNL270C_BY4742   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_CBS7960   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_CEN.PK   551   QIEELVWIEPECKTRWQRVWDVLS--   574
YNL270C_CLIB215   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_CLIB324   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_DBVPG6044   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_EC1118   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_EC9-8   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_FostersB   551   QIEELVWIEPECKTRWQRVWDVLS--   574
YNL270C_FostersO   
   --------------------------   
YNL270C_JAY291   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_K11   551   QIEELVWIEPECKTRWQRVWNVLS--   574
YNL270C_Kyokai7   551   QIEELVWIEPECKTRWQRVWNVLS--   574
YNL270C_L1528   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_LalvinQA23   397   QIEELVWIEPECKTRWQRVWDVLS--   420
YNL270C_SEY6210   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_T7   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_UC5   551   QIEELVWIEPECKTRWQRVWNVLS--   574
YNL270C_UWOPS05_217_3   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_VL3   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_Vin13   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_W303   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_Y10   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_Y55   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_YJM269   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_YJM789   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_YPH499   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_YPS128   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_YPS163   550   QIEELVWIEPECKTRWQRVWDVLS--   573
YNL270C_YS9   540   RRQIEELVWIEPECKTRWQRVWDVLS   565
YNL270C_ZTW1   551   QIEELVWIEPECKTRWQRVWNVLS--   574
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YNL270C_S288C from SGD:

YNL270C_S288C [source=SGD]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_AWRI796 from AWRI:

YNL270C_AWRI796 [source=AWRI]  Length: 274  Sat Aug 18 06:48:21 2018  Type: P  Check: 805  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFQVLEKSR

     251  SLGGLALSPV IKMRAVFSDG FPL*

Protein Sequence for YNL270C_BC187 from Stanford:

YNL270C_BC187 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9153  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_BY4741 from Stanford:

YNL270C_BY4741 [source=Stanford]  Length: 576  Sat Aug 18 06:48:21 2018  Type: P  Check: 460  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGXXXXXXX XXXXXXXXXX XXXXXXXAAF TYQGTELVGI TAGEAANPRK

     301  ALPRAIKKVV VRILVFYILS LFFIGLLVPY NDPKLDSDGI FVSSSPFMIS

     351  IENSGTKVLP DIFNAVVLIT ILSAGNSNVY IGSRVLYSLS KNSLAPRFLS

     401  NVTRGGVPYF SVLSTSVFGF LAFLEVSAGS GKAFNWLLNI TGVAGFFAWL

     451  LISFSHIRFM QAIRKRGISR DDLPYKAQMM PFLAYYASFF IALIVLIQGF

     501  TAFAPTFQPI DFVAAYISIF LFLAIWLSFQ VWFKCRLLWK LQDIDIDSDR

     551  RQIEELVWIE PECKTRWQRV WDVLS*

Protein Sequence for YNL270C_BY4742 from Stanford:

YNL270C_BY4742 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_CBS7960 from WashU:

YNL270C_CBS7960 [source=WashU]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_CEN.PK from Stanford:

YNL270C_CEN.PK [source=Stanford]  Length: 575  Sat Aug 18 06:48:21 2018  Type: P  Check: 22  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DDAAKETESS PQERREVKRK LKQRHIGMIA LGGTIGTGLI IGIGPPLAHA

     101  GPVGALISYL FMGTVIYSVT QSLGEMATFI PVTSSFSVFA QRFLSPALGA

     151  TNGYMYWLSW CFTFALELSV LGKVIQYWTE AVPLAAWIVI FWCLLTSMNM

     201  FPVKYYGEFE FCIASIKVIA LLGFIIFSFC VVCGAGQSDG PIGFRYWRNP

     251  GAWGPGIISS NKNEGRFLGW VSSLINAAFT YQGTELVGIT AGEAANPRKA

     301  LPRAIKKVVV RILVFYILSL FFIGLLVPYN DPKLDSDGIF VSSSPFMISI

     351  ENSGTKVLPD IFNAVVLITI LSAGNSNVYI GSRVLYSLSK NSLAPRFLSN

     401  VTRGGVPYFS VLSTSVFGFL AFLEVSAGSG KAFNWLLNIT GVAGFFAWLL

     451  ISFSHIRFMQ AIRKRGISRD DLPYKAQMMP FLAYYASFFI ALIVLIQGFT

     501  AFAPTFQPID FVAAYISVFL FLAIWLSFQV WFKCRLLWKL QDIDIDSDHR

     551  QIEELVWIEP ECKTRWQRVW DVLS*

Protein Sequence for YNL270C_CLIB215 from WashU:

YNL270C_CLIB215 [source=WashU]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_CLIB324 from WashU:

YNL270C_CLIB324 [source=WashU]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_DBVPG6044 from Stanford:

YNL270C_DBVPG6044 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 7828  ..

       1  MDETVNLQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKEAESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEE VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KSEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD FPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFHPIDF VAAYISVFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_EC1118 from Genoscope:

YNL270C_EC1118 [source=Genoscope]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_EC9-8 from ASinica:

YNL270C_EC9-8 [source=ASinica]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9089  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLLDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_FostersB from AWRI:

YNL270C_FostersB [source=AWRI]  Length: 575  Sat Aug 18 06:48:21 2018  Type: P  Check: 2929  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DDAAKETESS PQERREVKRK LXQRHIGMIA LGGTIXTGLI IGIGPPLAHA

     101  GPVGALISYL FMGTVIYSVT QSLGEMATFI XVTSSFSVFA QRFLSPALGA

     151  TNGYMYWLSW CFTFALELSV LGKVIQYWTE AVPLXAWIVI FWCLLTSMNM

     201  FPVKYYGEFE FCIASIKVIA LLGFIIFSFC VVCGAGQSDG PIGFRYWRNP

     251  GAWGPGIISS DKNEGRFLGW VSSLINAAFT YQGTELVGIT AGEAANPRKA

     301  LPRAIKKVVV RILVFYILSL FFIGLLVPYN DPKLDSDGIF VSSSPFMISI

     351  ENSGTKVLPD IFNAVVLITI LSAGNSNVYI GSRVLYSLSK NSLAPRFLSN

     401  VTRGGVPYFS VLSTSVFGFL AFLEVSAGSG KXFNWLLNIT GVAGFFAWLL

     451  ISXSHIRFMQ AIRKRGISRD DLPYKAQMMP FLAYYASFFI ALIVLIQGFT

     501  AFAPTFQPID FVAAYISVFL FLAIWLSFQV WFKCRLLWKL QDIDIDSDRR

     551  QIEELVWIEP ECKTRWQRVW DVLS*

Protein Sequence for YNL270C_FostersO from AWRI:

YNL270C_FostersO [source=AWRI]  Length: 422  Sat Aug 18 06:48:21 2018  Type: P  Check: 5400  ..

       1  MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT NGYMYWLSWC

      51  FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF PVKYYGEFEF

     101  CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG AWGPGIISSD

     151  KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL PRAIKKVVVR

     201  ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE NXGTKVLPDI

     251  FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV TRGGVPYFSV

     301  LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI SFSHIRFMQA

     351  IRKRGISRDD LPYKAQMMPF XGILCIFFHR SNCSDPGLHR FRTYFSAYRL

     401  CRCIYINIPI FGHMVIIPSL V*

Protein Sequence for YNL270C_JAY291 from Duke:

YNL270C_JAY291 [source=Duke]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9153  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_K11 from Stanford:

YNL270C_K11 [source=Stanford]  Length: 575  Sat Aug 18 06:48:21 2018  Type: P  Check: 237  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DDAAKETESS PQERREVKRK LKQRHIGMIA LGGTIGTGLI IGIGPPLAHA

     101  GPVGALISYL FMGTVIYSVT QSLGEMATFI PVTSSFSVFA QRFLSPALGA

     151  TNGYMYWLSW CFTFALELSV LGKVIQYWTE AVPLAAWIVI FWCLLTSMNM

     201  FPVKYYGEFE FCIASIKVIA LLGFIIFSFC VVCGAGQSDG PIGFRYWRNP

     251  GAWGPGIISS DKSEGRFLGW VSSLINAAFT YQGTELVGIT AGEAANPRKA

     301  LPRAIKKVVV RILVFYILSL FFIGLLVPYN DPKLDSDGIF VSSSPFMISI

     351  ENSGTKVLPD IFNAVVLITI LSAGNSNVYI GSRVLYSLSK NSLAPRFLSN

     401  VTRGGVPYFS VLSTSVFGFL AFLEVSAGSG KAFNWLLNIT GVAGFFAWLL

     451  ISFSHIRFMQ AIRKRGISRD DLPYKAQMMP FLAYYASFFI ALIVLIQGFT

     501  AFAPTFQPID FVAAYISVFL FLAIWLSFQV WFKCRLLWKL QDIDIDSDRR

     551  QIEELVWIEP ECKTRWQRVW NVLS*

Protein Sequence for YNL270C_Kyokai7 from NRIB:

YNL270C_Kyokai7 [source=NRIB]  Length: 575  Sat Aug 18 06:48:21 2018  Type: P  Check: 392  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DDAAKETESS PQERREVKRK LKQRHIGMIA LGGTIGTGLI IGIGPPLAHA

     101  GPVGALISYL FMGTVIYSVT QSLGEMATFI PVTSSFSVFA QRFLSPALGA

     151  TNGYMYWLSW CFTFALELSV LGKVIQYWTE AVPLAAWIVI FWCLLTSMNM

     201  FPVKYYGEFE FCIASIKVIA LLGFIIFSFC VVCGAGQSDG PIGFRYWRNP

     251  GAWGPGIISS NKNEGRFLGW VSSLINAAFT YQGTELVGIT AGEAANPRKA

     301  LPRAIKKVVV RILVFYILSL FFIGLLVPYN DPKLDSDGIF VSSSPFMISI

     351  ENSGTKVLPD IFNAVVLITI LSAGNSNVYI GSRVLYSLSK NSLAPRFLSN

     401  VTRGGVPYFS VLSTSVFGFL AFLEVSAGSG KAFNWLLNIT GVAGFFAWLL

     451  ISFSHIRFMQ AIRKRGISRD DLPYKAQMMP FLAYYASFFI ALIVLIQGFT

     501  AFAPTFQPID FVAAYISVFL FLAIWLSFQV WFKCRLLWKL QDIDIDSDRR

     551  QIEELVWIEP ECKTRWQRVW NVLS*

Protein Sequence for YNL270C_L1528 from Stanford:

YNL270C_L1528 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_LalvinQA23 from AWRI:

YNL270C_LalvinQA23 [source=AWRI]  Length: 421  Sat Aug 18 06:48:21 2018  Type: P  Check: 1376  ..

       1  MYWLSWCFTF ALELSVLGKV IQYWTEAVPL AAWIVIFWCL LTSMNMFPVK

      51  YYGEFEFCIA SIKVIALLGF IIFSFCVVCG AGQSDGPIGF RYWRNPGAWG

     101  PGIISSDKNE GRFLGWVSSL INAAFTYQGT ELVGITAGEA ANPRKALPRA

     151  IKKVVVRILV FYILSLFFIG LLVPYNDPKL DSDGIFVSSS PFMISIENSG

     201  TKVLPDIFNA VVLITILSAG NSNVYIGSRV LYSLSKNSLA PRFLSNVTRG

     251  GVPYFSVLST SVFGFLAFLE VSAGSGKAFN WLLNITGVAG FFAWLLISFS

     301  HIRFMQAIRK RGISRDDLPY KAQMMPFLAY YASFFIALIV LIQGFTAFAP

     351  TFQPIDFVAA YISIFLFLAI WLSFQVWFKC RLLWKLQDID IDSDRRQIEE

     401  LVWIEPECKT RWQRVWDVLS *

Protein Sequence for YNL270C_SEY6210 from Stanford:

YNL270C_SEY6210 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_T7 from WashU:

YNL270C_T7 [source=WashU]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 8863  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSHV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISVFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_UC5 from WashU:

YNL270C_UC5 [source=WashU]  Length: 575  Sat Aug 18 06:48:21 2018  Type: P  Check: 392  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DDAAKETESS PQERREVKRK LKQRHIGMIA LGGTIGTGLI IGIGPPLAHA

     101  GPVGALISYL FMGTVIYSVT QSLGEMATFI PVTSSFSVFA QRFLSPALGA

     151  TNGYMYWLSW CFTFALELSV LGKVIQYWTE AVPLAAWIVI FWCLLTSMNM

     201  FPVKYYGEFE FCIASIKVIA LLGFIIFSFC VVCGAGQSDG PIGFRYWRNP

     251  GAWGPGIISS NKNEGRFLGW VSSLINAAFT YQGTELVGIT AGEAANPRKA

     301  LPRAIKKVVV RILVFYILSL FFIGLLVPYN DPKLDSDGIF VSSSPFMISI

     351  ENSGTKVLPD IFNAVVLITI LSAGNSNVYI GSRVLYSLSK NSLAPRFLSN

     401  VTRGGVPYFS VLSTSVFGFL AFLEVSAGSG KAFNWLLNIT GVAGFFAWLL

     451  ISFSHIRFMQ AIRKRGISRD DLPYKAQMMP FLAYYASFFI ALIVLIQGFT

     501  AFAPTFQPID FVAAYISVFL FLAIWLSFQV WFKCRLLWKL QDIDIDSDRR

     551  QIEELVWIEP ECKTRWQRVW NVLS*

Protein Sequence for YNL270C_UWOPS05_217_3 from Stanford:

YNL270C_UWOPS05_217_3 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 8630  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETETSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQFDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYAFFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISVFLF LAIWLSFQVW FKCRLIWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_VL3 from AWRI:

YNL270C_VL3 [source=AWRI]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9153  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_Vin13 from AWRI:

YNL270C_Vin13 [source=AWRI]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9504  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMXTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTXVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_W303 from Stanford:

YNL270C_W303 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9405  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMVTFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_Y10 from WashU:

YNL270C_Y10 [source=WashU]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9268  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA LLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISVFLF LAIWLSFQVW FKCRLIWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_Y55 from Stanford:

YNL270C_Y55 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9153  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_YJM269 from WashU:

YNL270C_YJM269 [source=WashU]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9136  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISVFLF LAIWLSFQVW FKCRLIWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_YJM789 from Stanford:

YNL270C_YJM789 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9224  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWIQA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISVFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_YPH499 from Stanford:

YNL270C_YPH499 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9153  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISIFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_YPS128 from Stanford:

YNL270C_YPS128 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9205  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISVFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_YPS163 from Stanford:

YNL270C_YPS163 [source=Stanford]  Length: 574  Sat Aug 18 06:48:21 2018  Type: P  Check: 9205  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DAAKETESSP QERREVKRKL KQRHIGMIAL GGTIGTGLII GIGPPLAHAG

     101  PVGALISYLF MGTVIYSVTQ SLGEMATFIP VTSSFSVFAQ RFLSPALGAT

     151  NGYMYWLSWC FTFALELSVL GKVIQYWTEA VPLAAWIVIF WCLLTSMNMF

     201  PVKYYGEFEF CIASIKVIAL LGFIIFSFCV VCGAGQSDGP IGFRYWRNPG

     251  AWGPGIISSD KNEGRFLGWV SSLINAAFTY QGTELVGITA GEAANPRKAL

     301  PRAIKKVVVR ILVFYILSLF FIGLLVPYND PKLDSDGIFV SSSPFMISIE

     351  NSGTKVLPDI FNAVVLITIL SAGNSNVYIG SRVLYSLSKN SLAPRFLSNV

     401  TRGGVPYFSV LSTSVFGFLA FLEVSAGSGK AFNWLLNITG VAGFFAWLLI

     451  SFSHIRFMQA IRKRGISRDD LPYKAQMMPF LAYYASFFIA LIVLIQGFTA

     501  FAPTFQPIDF VAAYISVFLF LAIWLSFQVW FKCRLLWKLQ DIDIDSDRRQ

     551  IEELVWIEPE CKTRWQRVWD VLS*

Protein Sequence for YNL270C_YS9 from Stanford:

YNL270C_YS9 [source=Stanford]  Length: 566  Sat Aug 18 06:48:21 2018  Type: P  Check: 518  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DDAAKETESS PQERREVKRK LKQRHIGMIA LGGTIGTGLI IGIGPPLAHA

     101  GPVGALISYL FMGTVIYSVT QSLGEMATFI PVTSSFSVFA QRFLSPALGA

     151  TNGYMYWLSW CFTFALELSV LGKVIQYWTE AVPLAAWIVI FWCLLTSMNM

     201  FPVKYYGEFE FCIASIKVIA LLGFIIFSFC VVCGAGQSDG PIGFRYWRNP

     251  GAWGXXXXXX XXXXXXXXXX XXXXXXXVGI TAGEAANPRK ALPRAIKKVV

     301  VRILVFYILS LFFIGLLVPY NDPKLDSDGI FVSSSPFMIS IENSGTKVLP

     351  DIFNAVVLIT ILSAGNSNVY IGSRVLYSLS KNSLAPRFLS NVTRGGVPYF

     401  SVLSTSVFGF LAFLEVSAGS GKAFNWLLNI TGVAGFFAWL LISFSHIRFM

     451  QAIRKRGISR DDLPYKAQMM PFLAYYASFF IALIVLIQGF TAFAPTFQPI

     501  DFVAAYISIF LFLAIWLSFQ VWFKCRLLWK LQDIDIDSDR RQIEELVWIE

     551  PECKTRWQRV WDVLS*

Protein Sequence for YNL270C_ZTW1 from Zhejiang:

YNL270C_ZTW1 [source=Zhejiang]  Length: 575  Sat Aug 18 06:48:21 2018  Type: P  Check: 392  ..

       1  MDETVNIQMS KEGQYEINSS SIIKEEEFVD EQYSGENVTK AITTERKVED

      51  DDAAKETESS PQERREVKRK LKQRHIGMIA LGGTIGTGLI IGIGPPLAHA

     101  GPVGALISYL FMGTVIYSVT QSLGEMATFI PVTSSFSVFA QRFLSPALGA

     151  TNGYMYWLSW CFTFALELSV LGKVIQYWTE AVPLAAWIVI FWCLLTSMNM

     201  FPVKYYGEFE FCIASIKVIA LLGFIIFSFC VVCGAGQSDG PIGFRYWRNP

     251  GAWGPGIISS NKNEGRFLGW VSSLINAAFT YQGTELVGIT AGEAANPRKA

     301  LPRAIKKVVV RILVFYILSL FFIGLLVPYN DPKLDSDGIF VSSSPFMISI

     351  ENSGTKVLPD IFNAVVLITI LSAGNSNVYI GSRVLYSLSK NSLAPRFLSN

     401  VTRGGVPYFS VLSTSVFGFL AFLEVSAGSG KAFNWLLNIT GVAGFFAWLL

     451  ISFSHIRFMQ AIRKRGISRD DLPYKAQMMP FLAYYASFFI ALIVLIQGFT

     501  AFAPTFQPID FVAAYISVFL FLAIWLSFQV WFKCRLLWKL QDIDIDSDRR

     551  QIEELVWIEP ECKTRWQRVW NVLS*