BSC4/YNL269W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YNL269W_S288C   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_AWRI1631   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_AWRI796   
   --------------------------------------------------   
YNL269W_BC187   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_BY4741   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_BY4742   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_CBS7960   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_CEN.PK   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_CLIB215   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_CLIB324   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_CLIB382   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_D273-10B   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_EC1118   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_EC9-8   
   --------------------------------------------------   
YNL269W_FL100   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_FY1679   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_FostersB   
   --------------------------------------------------   
YNL269W_FostersO   1   MSIVLRKSNKKNKKLHNKQVLYNTHYKNFYSGVPSSHCHWRKPLCGVELP   50
YNL269W_JAY291   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_JK9-3d   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_K11   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_Kyokai7   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_L1528   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_LalvinQA23   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_PW5   1   MSIVLQKSNKKKQKLHNKQVLYNTHYKNFYSGVPTSHCHWRKPLCGVELP   50
YNL269W_RM11-1a   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_RedStar   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_SEY6210   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_T73   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_UC5   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_VL3   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_Vin13   1   MSIVLRKSNKKKQKLHNKQVLYNTHYKNFYSGVPSSHCHWRKPLCGVELP   50
YNL269W_W303   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_X2180-1A   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_Y55   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_YJM789   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
YNL269W_YPH499   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_YS9   1   MSIVLRKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGESPYVEWSCL   50
YNL269W_ZTW1   1   MSIVLQKSNKKNKNCITSKFYTIHIIKISTPVFRAPIAIGENPYVEWSCL   50
         

YNL269W_S288C   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_AWRI1631   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_AWRI796   1   -------MVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   42
YNL269W_BC187   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_BY4741   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_BY4742   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_CBS7960   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_CEN.PK   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_CLIB215   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALNAATQKHTSCAARQFLAL-   98
YNL269W_CLIB324   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_CLIB382   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_D273-10B   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_EC1118   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_EC9-8   1   -------MVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   42
YNL269W_FL100   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_FY1679   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_FostersB   1   -------MVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFXAM   42
YNL269W_FostersO   51   TGCFQERHGYKKDDIRPTYHSLEPLFYAKPLNAATXKTYILCRTAVFXAM   100
YNL269W_JAY291   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_JK9-3d   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_K11   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_Kyokai7   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_L1528   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_LalvinQA23   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_PW5   51   TGCFHERHGYKKDDIRPTYHSLEPLFMPSP--------------------   80
YNL269W_RM11-1a   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_RedStar   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_SEY6210   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_T73   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_UC5   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_VL3   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_Vin13   51   TGCFQERHGYKKDDIRPTYHSLEPLFYAKPLNAAT-QKHTYCAARQFLAL   99
YNL269W_W303   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_X2180-1A   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_Y55   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_YJM789   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_YPH499   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_YS9   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
YNL269W_ZTW1   51   QVVFRKDMVTKKTTFAQLITRLN-HFLCQALKRRDSKTYILCRTAVFGAM   99
         

YNL269W_S288C   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_AWRI1631   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_AWRI796   43   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   74
YNL269W_BC187   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_BY4741   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_BY4742   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_CBS7960   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_CEN.PK   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_CLIB215   
   --------------------------------------------------   
YNL269W_CLIB324   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_CLIB382   100   TPFSPRKSHINNKLPMQPRKKKIVIICVVRFH------------------   131
YNL269W_D273-10B   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_EC1118   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_EC9-8   43   TPFSPRKSHINNKLPMQPRKKNSHYIRSALSLTTTFLCNFWYTATRIESA   92
YNL269W_FL100   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_FY1679   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_FostersB   43   TPFSPRKSHXNNKLPMQPRKKKIVIIYVXRFH------------------   74
YNL269W_FostersO   101   TPFSPRKSHINNKLPMQPRKKKXSHYIRSXLSLTTTFLCNFWYTATRIES   150
YNL269W_JAY291   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_JK9-3d   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_K11   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_Kyokai7   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_L1528   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_LalvinQA23   100   TPFSPRKSHINNKLPMQPRKKKISHYIRSXLSLTTTFLCNFWYTATRIES   149
YNL269W_PW5   
   --------------------------------------------------   
YNL269W_RM11-1a   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_RedStar   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_SEY6210   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_T73   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_UC5   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_VL3   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_Vin13   
   --------------------------------------------------   
YNL269W_W303   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_X2180-1A   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_Y55   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_YJM789   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_YPH499   100   TPFSPRKSHINNKLPMQPRKKKIVIIYVVRFH------------------   131
YNL269W_YS9   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
YNL269W_ZTW1   100   TPFSPRKSHINNKLPMQPRKKK----------------------------   121
         

YNL269W_S288C   
   ------------------   
YNL269W_AWRI1631   
   ------------------   
YNL269W_AWRI796   
   ------------------   
YNL269W_BC187   
   ------------------   
YNL269W_BY4741   
   ------------------   
YNL269W_BY4742   
   ------------------   
YNL269W_CBS7960   
   ------------------   
YNL269W_CEN.PK   
   ------------------   
YNL269W_CLIB215   
   ------------------   
YNL269W_CLIB324   
   ------------------   
YNL269W_CLIB382   
   ------------------   
YNL269W_D273-10B   
   ------------------   
YNL269W_EC1118   
   ------------------   
YNL269W_EC9-8   93   KDYSSSSR----------   100
YNL269W_FL100   
   ------------------   
YNL269W_FY1679   
   ------------------   
YNL269W_FostersB   
   ------------------   
YNL269W_FostersO   151   AKDYSSSSR---------   159
YNL269W_JAY291   
   ------------------   
YNL269W_JK9-3d   
   ------------------   
YNL269W_K11   
   ------------------   
YNL269W_Kyokai7   
   ------------------   
YNL269W_L1528   
   ------------------   
YNL269W_LalvinQA23   150   AKDYSSSSRXNXHRWATT   167
YNL269W_PW5   
   ------------------   
YNL269W_RM11-1a   
   ------------------   
YNL269W_RedStar   
   ------------------   
YNL269W_SEY6210   
   ------------------   
YNL269W_T73   
   ------------------   
YNL269W_UC5   
   ------------------   
YNL269W_VL3   
   ------------------   
YNL269W_Vin13   
   ------------------   
YNL269W_W303   
   ------------------   
YNL269W_X2180-1A   
   ------------------   
YNL269W_Y55   
   ------------------   
YNL269W_YJM789   
   ------------------   
YNL269W_YPH499   
   ------------------   
YNL269W_YS9   
   ------------------   
YNL269W_ZTW1   
   ------------------   
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YNL269W_S288C from SGD:

YNL269W_S288C [source=SGD]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_AWRI1631 from AWRI:

YNL269W_AWRI1631 [source=AWRI]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_AWRI796 from AWRI:

YNL269W_AWRI796 [source=AWRI]  Length: 75  Thu Aug 16 14:58:26 2018  Type: P  Check: 9608  ..

       1  MVTKKTTFAQ LITRLNHFLC QALKRRDSKT YILCRTAVFG AMTPFSPRKS

      51  HINNKLPMQP RKKKIVIIYV VRFH*

Protein Sequence for YNL269W_BC187 from Stanford:

YNL269W_BC187 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_BY4741 from Stanford:

YNL269W_BY4741 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_BY4742 from Stanford:

YNL269W_BY4742 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_CBS7960 from WashU:

YNL269W_CBS7960 [source=WashU]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_CEN.PK from Stanford:

YNL269W_CEN.PK [source=Stanford]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6768  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_CLIB215 from WashU:

YNL269W_CLIB215 [source=WashU]  Length: 99  Thu Aug 16 14:58:26 2018  Type: P  Check: 3428  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL NAATQKHTSC AARQFLAL*


Protein Sequence for YNL269W_CLIB324 from WashU:

YNL269W_CLIB324 [source=WashU]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_CLIB382 from WashU:

YNL269W_CLIB382 [source=WashU]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 6779  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIICVVRF H*

Protein Sequence for YNL269W_D273-10B from Stanford:

YNL269W_D273-10B [source=Stanford]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6768  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_EC1118 from Genoscope:

YNL269W_EC1118 [source=Genoscope]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6984  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_EC9-8 from ASinica:

YNL269W_EC9-8 [source=ASinica]  Length: 101  Thu Aug 16 14:58:26 2018  Type: P  Check: 2941  ..

       1  MVTKKTTFAQ LITRLNHFLC QALKRRDSKT YILCRTAVFG AMTPFSPRKS

      51  HINNKLPMQP RKKNSHYIRS ALSLTTTFLC NFWYTATRIE SAKDYSSSSR

     101  *

Protein Sequence for YNL269W_FL100 from Stanford:

YNL269W_FL100 [source=Stanford]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6768  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_FY1679 from Stanford:

YNL269W_FY1679 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_FostersB from AWRI:

YNL269W_FostersB [source=AWRI]  Length: 75  Thu Aug 16 14:58:26 2018  Type: P  Check: 1096  ..

       1  MVTKKTTFAQ LITRLNHFLC QALKRRDSKT YILCRTAVFX AMTPFSPRKS

      51  HXNNKLPMQP RKKKIVIIYV XRFH*

Protein Sequence for YNL269W_FostersO from AWRI:

YNL269W_FostersO [source=AWRI]  Length: 160  Thu Aug 16 14:58:26 2018  Type: P  Check: 8651  ..

       1  MSIVLRKSNK KNKKLHNKQV LYNTHYKNFY SGVPSSHCHW RKPLCGVELP

      51  TGCFQERHGY KKDDIRPTYH SLEPLFYAKP LNAATXKTYI LCRTAVFXAM

     101  TPFSPRKSHI NNKLPMQPRK KKXSHYIRSX LSLTTTFLCN FWYTATRIES

     151  AKDYSSSSR*

Protein Sequence for YNL269W_JAY291 from Duke:

YNL269W_JAY291 [source=Duke]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_JK9-3d from Stanford:

YNL269W_JK9-3d [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_K11 from Stanford:

YNL269W_K11 [source=Stanford]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6768  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_Kyokai7 from NRIB:

YNL269W_Kyokai7 [source=NRIB]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6768  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_L1528 from Stanford:

YNL269W_L1528 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_LalvinQA23 from AWRI:

YNL269W_LalvinQA23 [source=AWRI]  Length: 168  Thu Aug 16 14:58:26 2018  Type: P  Check: 385  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KISHYIRSXL SLTTTFLCNF WYTATRIESA

     151  KDYSSSSRXN XHRWATT*

Protein Sequence for YNL269W_PW5 from WashU:

YNL269W_PW5 [source=WashU]  Length: 81  Thu Aug 16 14:58:26 2018  Type: P  Check: 9492  ..

       1  MSIVLQKSNK KKQKLHNKQV LYNTHYKNFY SGVPTSHCHW RKPLCGVELP

      51  TGCFHERHGY KKDDIRPTYH SLEPLFMPSP *

Protein Sequence for YNL269W_RM11-1a from Stanford:

YNL269W_RM11-1a [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_RedStar from Stanford:

YNL269W_RedStar [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7043  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_SEY6210 from Stanford:

YNL269W_SEY6210 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_T73 from WashU:

YNL269W_T73 [source=WashU]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_UC5 from WashU:

YNL269W_UC5 [source=WashU]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6768  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_VL3 from AWRI:

YNL269W_VL3 [source=AWRI]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_Vin13 from AWRI:

YNL269W_Vin13 [source=AWRI]  Length: 100  Thu Aug 16 14:58:26 2018  Type: P  Check: 7164  ..

       1  MSIVLRKSNK KKQKLHNKQV LYNTHYKNFY SGVPSSHCHW RKPLCGVELP

      51  TGCFQERHGY KKDDIRPTYH SLEPLFYAKP LNAATQKHTY CAARQFLAL*


Protein Sequence for YNL269W_W303 from Stanford:

YNL269W_W303 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_X2180-1A from Stanford:

YNL269W_X2180-1A [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_Y55 from Stanford:

YNL269W_Y55 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_YJM789 from Stanford:

YNL269W_YJM789 [source=Stanford]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6774  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_YPH499 from Stanford:

YNL269W_YPH499 [source=Stanford]  Length: 132  Thu Aug 16 14:58:26 2018  Type: P  Check: 7259  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK KIVIIYVVRF H*

Protein Sequence for YNL269W_YS9 from Stanford:

YNL269W_YS9 [source=Stanford]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6984  ..

       1  MSIVLRKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ESPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*

Protein Sequence for YNL269W_ZTW1 from Zhejiang:

YNL269W_ZTW1 [source=Zhejiang]  Length: 122  Thu Aug 16 14:58:26 2018  Type: P  Check: 6768  ..

       1  MSIVLQKSNK KNKNCITSKF YTIHIIKIST PVFRAPIAIG ENPYVEWSCL

      51  QVVFRKDMVT KKTTFAQLIT RLNHFLCQAL KRRDSKTYIL CRTAVFGAMT

     101  PFSPRKSHIN NKLPMQPRKK K*