LYP1/YNL268W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YNL268W_S288C   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_AWRI796   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_BC187   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_BY4741   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_BY4742   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_CBS7960   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_CEN.PK   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_CLIB215   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_D273-10B   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_DBVPG6044   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYF   50
YNL268W_EC1118   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_EC9-8   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_FL100   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_FostersB   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYX   50
YNL268W_FostersO   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_JAY291   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_JK9-3d   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_K11   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_Kyokai7   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_L1528   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_LalvinQA23   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_RM11-1a   1   ------------------------------------MEAIDPSNKTTPYS   14
YNL268W_RedStar   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_SEY6210   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_SK1   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYF   50
YNL268W_T7   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEVIDPNNKTIPYS   50
YNL268W_UC5   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_UWOPS05_217_3   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEVIDPNNKTIPYS   50
YNL268W_VL3   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_Vin13   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_W303   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_X2180-1A   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_Y55   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_YJM269   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_YJM789   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_YPH499   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_YPS128   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEVIDPNNKTIPYS   50
YNL268W_YPS163   1   ------------------------MQELPEDQIEHEMEVIDPNNKTIPYS   26
YNL268W_YS9   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
YNL268W_ZTW1   1   MGRFSNIITSNKWDEKQNNIGEQSMQELPEDQIEHEMEAIDPSNKTTPYS   50
         

YNL268W_S288C   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_AWRI796   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_BC187   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_BY4741   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_BY4742   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_CBS7960   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_CEN.PK   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_CLIB215   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_D273-10B   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_DBVPG6044   51   IDEKKYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_EC1118   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_EC9-8   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_FL100   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_FostersB   51   IDEKQYNTKKKHGSLQGGAIADVNSIXNSLTRLQVVSHEXDIXEDEEEAH   100
YNL268W_FostersO   51   IDEKQYNTKKKHGSLQGGAIADVNSINNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_JAY291   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_JK9-3d   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_K11   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_Kyokai7   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_L1528   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_LalvinQA23   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_RM11-1a   15   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   64
YNL268W_RedStar   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_SEY6210   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_SK1   51   IDEKKYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_T7   51   IDEKQYNTKKKHGSLQGSAFADVNSITNSLTRSQIVSHEPGIDEDEEEAH   100
YNL268W_UC5   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_UWOPS05_217_3   51   IDEKQYNTKKKHGSLQGSAFADVNSITNSLTRSQIVSHEPGIDEDEEEAH   100
YNL268W_VL3   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_Vin13   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_W303   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_X2180-1A   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_Y55   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_YJM269   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
YNL268W_YJM789   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLRVVSHEPDIDEDEEEAH   100
YNL268W_YPH499   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_YPS128   51   IDEKQYNTKKKHGSLQGSAFADVNSITNSLTRSQIVSHEPGIDEDEEEAH   100
YNL268W_YPS163   27   IDEKQYNTKKKHGSLQGSAFADVNSITNSLTRSQIVSHEPGIDEDEEEAH   76
YNL268W_YS9   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAH   100
YNL268W_ZTW1   51   IDEKQYNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHEPDIDEDEEEAH   100
         

YNL268W_S288C   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_AWRI796   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_BC187   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_BY4741   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_BY4742   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_CBS7960   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_CEN.PK   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_CLIB215   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_D273-10B   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_DBVPG6044   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_EC1118   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_EC9-8   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_FL100   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_FostersB   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_FostersO   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_JAY291   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_JK9-3d   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_K11   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_Kyokai7   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_L1528   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_LalvinQA23   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_RM11-1a   65   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   114
YNL268W_RedStar   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_SEY6210   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_SK1   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_T7   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_UC5   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_UWOPS05_217_3   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_VL3   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_Vin13   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_W303   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_X2180-1A   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_Y55   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_YJM269   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_YJM789   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_YPH499   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_YPS128   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_YPS163   77   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   126
YNL268W_YS9   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
YNL268W_ZTW1   101   YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIF   150
         

YNL268W_S288C   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_AWRI796   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_BC187   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_BY4741   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_BY4742   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_CBS7960   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_CEN.PK   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_CLIB215   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_D273-10B   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_DBVPG6044   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_EC1118   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_EC9-8   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_FL100   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_FostersB   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNXYMYWFNWA   200
YNL268W_FostersO   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_JAY291   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_JK9-3d   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_K11   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_Kyokai7   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_L1528   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_LalvinQA23   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_RM11-1a   115   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   164
YNL268W_RedStar   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_SEY6210   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_SK1   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_T7   151   MGTVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_UC5   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_UWOPS05_217_3   151   MGTVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_VL3   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_Vin13   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_W303   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_X2180-1A   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_Y55   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_YJM269   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_YJM789   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_YPH499   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_YPS128   151   MGTVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_YPS163   127   MGTVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   176
YNL268W_YS9   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
YNL268W_ZTW1   151   MGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWA   200
         

YNL268W_S288C   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_AWRI796   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_BC187   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_BY4741   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_BY4742   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_CBS7960   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_CEN.PK   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_CLIB215   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_D273-10B   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_DBVPG6044   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_EC1118   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_EC9-8   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_FL100   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_FostersB   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_FostersO   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_JAY291   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_JK9-3d   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_K11   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_Kyokai7   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_L1528   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_LalvinQA23   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_RM11-1a   165   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   214
YNL268W_RedStar   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_SEY6210   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_SK1   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_T7   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_UC5   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_UWOPS05_217_3   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_VL3   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_Vin13   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_W303   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_X2180-1A   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_Y55   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_YJM269   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_YJM789   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_YPH499   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_YPS128   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_YPS163   177   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   226
YNL268W_YS9   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
YNL268W_ZTW1   201   ITYAVEVSVIGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEF   250
         

YNL268W_S288C   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_AWRI796   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAXGARHHLQ--   298
YNL268W_BC187   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_BY4741   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_BY4742   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_CBS7960   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_CEN.PK   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSNK   300
YNL268W_CLIB215   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_D273-10B   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSNK   300
YNL268W_DBVPG6044   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_EC1118   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_EC9-8   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_FL100   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSNK   300
YNL268W_FostersB   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_FostersO   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_JAY291   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_JK9-3d   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_K11   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_Kyokai7   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_L1528   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_LalvinQA23   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_RM11-1a   215   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGXXXXXXXX   264
YNL268W_RedStar   251   WVASVKVLAIMGYLIYALIITVP---------------------------   273
YNL268W_SEY6210   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_SK1   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGXXXXXXXX   300
YNL268W_T7   251   WVASVKVLAIIGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_UC5   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_UWOPS05_217_3   251   WVASVKVLAIIGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_VL3   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_Vin13   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_W303   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_X2180-1A   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_Y55   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_YJM269   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_YJM789   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_YPH499   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_YPS128   251   WVASVKVLAIIGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
YNL268W_YPS163   227   WVASVKVLAIIGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   276
YNL268W_YS9   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGXXXXXXXXXXXXXXXXXXX   300
YNL268W_ZTW1   251   WVASVKVLAIMGYLIYALIIVCGGSHQGPIGFRYWRNPGAWGPGIISSDK   300
         

YNL268W_S288C   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_AWRI796   
   --------------------------------------------------   
YNL268W_BC187   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_BY4741   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_BY4742   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_CBS7960   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_CEN.PK   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_CLIB215   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_D273-10B   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_DBVPG6044   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_EC1118   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_EC9-8   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_FL100   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_FostersB   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_FostersO   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_JAY291   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_JK9-3d   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_K11   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_Kyokai7   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_L1528   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_LalvinQA23   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_RM11-1a   265   XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX   314
YNL268W_RedStar   
   --------------------------------------------------   
YNL268W_SEY6210   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_SK1   301   X-------------------------------------------------   301
YNL268W_T7   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_UC5   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_UWOPS05_217_3   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_VL3   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_Vin13   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_W303   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_X2180-1A   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_Y55   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_YJM269   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_YJM789   301   SEGRFLGWVSSLIN------------------------------------   314
YNL268W_YPH499   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_YPS128   301   NEGRFLGWVSSLIN------------------------------------   314
YNL268W_YPS163   277   NEGRFLGWVSSLIN------------------------------------   290
YNL268W_YS9   301   XXXXXXXXXXXXXX------------------------------------   314
YNL268W_ZTW1   301   SEGRFLGWVSSLIN------------------------------------   314
         

YNL268W_S288C   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_AWRI796   
   --------------------------------------------------   
YNL268W_BC187   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_BY4741   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_BY4742   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_CBS7960   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_CEN.PK   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_CLIB215   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_D273-10B   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_DBVPG6044   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_EC1118   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_EC9-8   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_FL100   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_FostersB   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_FostersO   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_JAY291   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_JK9-3d   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_K11   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_Kyokai7   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_L1528   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_LalvinQA23   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_RM11-1a   315   XXXXXXXXAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   364
YNL268W_RedStar   274   ----------------------------------RAINKVVFRIVLFYIM   289
YNL268W_SEY6210   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_SK1   302   --------------------------------------------VLFYIM   307
YNL268W_T7   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_UC5   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_UWOPS05_217_3   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_VL3   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_Vin13   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_W303   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_X2180-1A   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_Y55   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_YJM269   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_YJM789   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_YPH499   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_YPS128   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_YPS163   291   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   332
YNL268W_YS9   315   --------XXXXXXXXXXXXXTAGEAANPRKTVPRAINKVVFRIVLFYIM   356
YNL268W_ZTW1   315   --------AAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIM   356
         

YNL268W_S288C   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_AWRI796   
   --------------------------------------------------   
YNL268W_BC187   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_BY4741   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_BY4742   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_CBS7960   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_CEN.PK   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_CLIB215   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_D273-10B   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_DBVPG6044   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_EC1118   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_EC9-8   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_FL100   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_FostersB   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAXTYALPDIFNAVVLI   406
YNL268W_FostersO   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_JAY291   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_JK9-3d   357   SLFFIGLLVPFNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_K11   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPNIFNAVVLI   406
YNL268W_Kyokai7   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_L1528   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_LalvinQA23   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_RM11-1a   365   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   414
YNL268W_RedStar   290   SLFFIGLLVPFNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   339
YNL268W_SEY6210   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_SK1   308   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   357
YNL268W_T7   357   SLFFVGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_UC5   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_UWOPS05_217_3   357   SLFFVGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_VL3   357   SLFFIGLLVPYNDSRLSASSAVIASSPFXISIQNAGTYALPDIFNAVVLI   406
YNL268W_Vin13   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_W303   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_X2180-1A   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_Y55   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_YJM269   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_YJM789   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_YPH499   357   SLFFIGLLVPFNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_YPS128   357   SLFFVGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_YPS163   333   SLFFVGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   382
YNL268W_YS9   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
YNL268W_ZTW1   357   SLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFNAVVLI   406
         

YNL268W_S288C   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_AWRI796   
   --------------------------------------------------   
YNL268W_BC187   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_BY4741   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_BY4742   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_CBS7960   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_CEN.PK   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_CLIB215   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_D273-10B   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_DBVPG6044   407   TVISAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_EC1118   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_EC9-8   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_FL100   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_FostersB   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_FostersO   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_JAY291   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_JK9-3d   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_K11   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_Kyokai7   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_L1528   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_LalvinQA23   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_RM11-1a   415   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   464
YNL268W_RedStar   340   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   389
YNL268W_SEY6210   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_SK1   358   TVISAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   407
YNL268W_T7   407   TVVSAANSNVYVGSRVLYSLAKSGNAPKQFGYVTRQGVPYLGVICTAALG   456
YNL268W_UC5   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_UWOPS05_217_3   407   TVVSAANSNVYVGSRVLYSLAKSGNAPKQFGYVTRQGVPYLGVICTAALG   456
YNL268W_VL3   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_Vin13   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_W303   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_X2180-1A   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_Y55   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_YJM269   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_YJM789   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_YPH499   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_YPS128   407   TVVSAANSNVYVGSRVLYSLAKSGNAPKQFGYVTRQGVPYLGVICTAALG   456
YNL268W_YPS163   383   TVVSAANSNVYVGSRVLYSLAKSGNAPKQFGYVTRQGVPYLGVICTAALG   432
YNL268W_YS9   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
YNL268W_ZTW1   407   TVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALG   456
         

YNL268W_S288C   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_AWRI796   
   --------------------------------------------------   
YNL268W_BC187   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_BY4741   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_BY4742   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_CBS7960   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_CEN.PK   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_CLIB215   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_D273-10B   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_DBVPG6044   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_EC1118   457   LLAFLVVSNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_EC9-8   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_FL100   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_FostersB   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_FostersO   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_JAY291   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_JK9-3d   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_K11   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_Kyokai7   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_L1528   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_LalvinQA23   457   LLAFLVVXNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_RM11-1a   465   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   514
YNL268W_RedStar   390   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   439
YNL268W_SEY6210   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_SK1   408   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   457
YNL268W_T7   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_UC5   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_UWOPS05_217_3   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_VL3   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_Vin13   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_W303   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_X2180-1A   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_Y55   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_YJM269   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_YJM789   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_YPH499   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_YPS128   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_YPS163   433   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   482
YNL268W_YS9   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
YNL268W_ZTW1   457   LLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGIS   506
         

YNL268W_S288C   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_AWRI796   
   --------------------------------------------------   
YNL268W_BC187   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_BY4741   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_BY4742   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_CBS7960   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_CEN.PK   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_CLIB215   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_D273-10B   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_DBVPG6044   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_EC1118   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_EC9-8   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_FL100   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_FostersB   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_FostersO   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_JAY291   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_JK9-3d   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_K11   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_Kyokai7   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_L1528   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_LalvinQA23   507   RDDLPFKAKLMPYGAYYAAFFVTXIIFIQGFQAFCXFKVSEFFTSYISLI   556
YNL268W_RM11-1a   515   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   564
YNL268W_RedStar   440   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   489
YNL268W_SEY6210   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_SK1   458   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   507
YNL268W_T7   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_UC5   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_UWOPS05_217_3   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_VL3   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_Vin13   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_W303   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_X2180-1A   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_Y55   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_YJM269   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_YJM789   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_YPH499   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_YPS128   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_YPS163   483   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   532
YNL268W_YS9   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
YNL268W_ZTW1   507   RDDLPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCPFKVSEFFTSYISLI   556
         

YNL268W_S288C   557   LLAVVFIGCQIYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKF   606
YNL268W_AWRI796   
   --------------------------------