GIM3/YNL153C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YNL153C_S288C   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_AWRI1631   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_AWRI796   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_BC187   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_BY4741   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_BY4742   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_CBS7960   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_CEN.PK   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_CLIB215   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_CLIB324   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_D273-10B   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_DBVPG6044   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_EC1118   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_EC9-8   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_FL100   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_FY1679   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_FostersB   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_FostersO   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_JAY291   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_JK9-3d   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_K11   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_Kyokai7   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_L1528   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_LalvinQA23   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_M22   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_PW5   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_RM11-1a   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_RedStar   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_SEY6210   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_SK1   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_T7   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_T73   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_UC5   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_UWOPS05_217_3   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_VL3   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_Vin13   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_W303   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_X2180-1A   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_Y55   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_YJM269   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_YJM339   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_YJM789   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_YPH499   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_YPS128   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_YPS163   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_YS9   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
YNL153C_ZTW1   1   MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLD   50
         

YNL153C_S288C   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_AWRI1631   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_AWRI796   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_BC187   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_BY4741   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_BY4742   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_CBS7960   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_CEN.PK   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_CLIB215   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_CLIB324   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_D273-10B   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_DBVPG6044   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQGKVTAQLEKDAERLDNKIETLE   100
YNL153C_EC1118   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_EC9-8   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_FL100   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_FY1679   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_FostersB   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_FostersO   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_JAY291   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_JK9-3d   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_K11   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_Kyokai7   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_L1528   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_LalvinQA23   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_M22   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_PW5   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLYNKIETLE   100
YNL153C_RM11-1a   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_RedStar   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_SEY6210   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_SK1   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_T7   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_T73   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_UC5   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_UWOPS05_217_3   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_VL3   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_Vin13   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_W303   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_X2180-1A   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_Y55   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQGKVTAQLEKDAERLDNKIETLE   100
YNL153C_YJM269   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_YJM339   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_YJM789   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_YPH499   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_YPS128   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_YPS163   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_YS9   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
YNL153C_ZTW1   51   DVSLEIELIDEDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLE   100
         

YNL153C_S288C   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_AWRI1631   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_AWRI796   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_BC187   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_BY4741   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_BY4742   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_CBS7960   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_CEN.PK   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_CLIB215   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_CLIB324   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_D273-10B   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_DBVPG6044   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_EC1118   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_EC9-8   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_FL100   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_FY1679   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_FostersB   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_FostersO   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_JAY291   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_JK9-3d   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_K11   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_Kyokai7   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_L1528   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_LalvinQA23   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_M22   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_PW5   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_RM11-1a   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_RedStar   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_SEY6210   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_SK1   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_T7   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_T73   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_UC5   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_UWOPS05_217_3   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_VL3   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_Vin13   101   DKQRDIDSRLDALKAXLYAKFGDNINLER   129
YNL153C_W303   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_X2180-1A   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_Y55   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_YJM269   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_YJM339   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_YJM789   101   DKQRDIDSRLDALKANLYAKFGDNINLER   129
YNL153C_YPH499   101   DKQRDIDSRLDALKAILYAKFGDNINLER   129
YNL153C_YPS128   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_YPS163   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_YS9   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
YNL153C_ZTW1   101   DKQRDIDSRLDALKATLYAKFGDNINLER   129
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YNL153C_S288C from SGD:

YNL153C_S288C [source=SGD]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_AWRI1631 from AWRI:

YNL153C_AWRI1631 [source=AWRI]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_AWRI796 from AWRI:

YNL153C_AWRI796 [source=AWRI]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_BC187 from Stanford:

YNL153C_BC187 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_BY4741 from Stanford:

YNL153C_BY4741 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_BY4742 from Stanford:

YNL153C_BY4742 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_CBS7960 from WashU:

YNL153C_CBS7960 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_CEN.PK from Stanford:

YNL153C_CEN.PK [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_CLIB215 from WashU:

YNL153C_CLIB215 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_CLIB324 from WashU:

YNL153C_CLIB324 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_D273-10B from Stanford:

YNL153C_D273-10B [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_DBVPG6044 from Stanford:

YNL153C_DBVPG6044 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 6823  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQGK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_EC1118 from Genoscope:

YNL153C_EC1118 [source=Genoscope]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_EC9-8 from ASinica:

YNL153C_EC9-8 [source=ASinica]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_FL100 from Stanford:

YNL153C_FL100 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_FY1679 from Stanford:

YNL153C_FY1679 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_FostersB from AWRI:

YNL153C_FostersB [source=AWRI]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_FostersO from AWRI:

YNL153C_FostersO [source=AWRI]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_JAY291 from Duke:

YNL153C_JAY291 [source=Duke]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_JK9-3d from Stanford:

YNL153C_JK9-3d [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_K11 from Stanford:

YNL153C_K11 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_Kyokai7 from NRIB:

YNL153C_Kyokai7 [source=NRIB]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_L1528 from Stanford:

YNL153C_L1528 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_LalvinQA23 from AWRI:

YNL153C_LalvinQA23 [source=AWRI]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_M22 from WashU:

YNL153C_M22 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_PW5 from WashU:

YNL153C_PW5 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7843  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLYNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_RM11-1a from Stanford:

YNL153C_RM11-1a [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_RedStar from Stanford:

YNL153C_RedStar [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_SEY6210 from Stanford:

YNL153C_SEY6210 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_SK1 from Stanford:

YNL153C_SK1 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_T7 from WashU:

YNL153C_T7 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_T73 from WashU:

YNL153C_T73 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_UC5 from WashU:

YNL153C_UC5 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_UWOPS05_217_3 from Stanford:

YNL153C_UWOPS05_217_3 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_VL3 from AWRI:

YNL153C_VL3 [source=AWRI]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_Vin13 from AWRI:

YNL153C_Vin13 [source=AWRI]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7095  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAXLYAK FGDNINLER*

Protein Sequence for YNL153C_W303 from Stanford:

YNL153C_W303 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_X2180-1A from Stanford:

YNL153C_X2180-1A [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_Y55 from Stanford:

YNL153C_Y55 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 6823  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQGK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_YJM269 from WashU:

YNL153C_YJM269 [source=WashU]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_YJM339 from Stanford:

YNL153C_YJM339 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_YJM789 from Stanford:

YNL153C_YJM789 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7075  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKANLYAK FGDNINLER*

Protein Sequence for YNL153C_YPH499 from Stanford:

YNL153C_YPH499 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7065  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKAILYAK FGDNINLER*

Protein Sequence for YNL153C_YPS128 from Stanford:

YNL153C_YPS128 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_YPS163 from Stanford:

YNL153C_YPS163 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_YS9 from Stanford:

YNL153C_YS9 [source=Stanford]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*

Protein Sequence for YNL153C_ZTW1 from Zhejiang:

YNL153C_ZTW1 [source=Zhejiang]  Length: 130  Tue Sep 19 04:35:41 2017  Type: P  Check: 7087  ..

       1  MELLPQGQRN NTQVTFEDQQ KINEFSKLIM RKDAIAQELS LQREEKEYLD

      51  DVSLEIELID EDEPVQYKVG DLFIFMKQSK VTAQLEKDAE RLDNKIETLE

     101  DKQRDIDSRL DALKATLYAK FGDNINLER*