SRT1/YMR101C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YMR101C_S288C   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_AWRI1631   
   --------------------------------------------------   
YMR101C_AWRI796   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_BC187   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_BY4741   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_BY4742   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_CEN.PK   1   MKIPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_D273-10B   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_DBVPG6044   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_EC1118   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFEWVMSLSLFSWFY   50
YMR101C_FL100   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_FY1679   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_FostersB   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_FostersO   1   MKMPSXIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_JAY291   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_JK9-3d   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_K11   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_Kyokai7   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_L1528   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_LalvinQA23   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFXWVMSLSLFSWFY   50
YMR101C_RM11-1a   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_RedStar   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_SEY6210   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_SK1   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_T7   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_T73   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFEWVMSLSLFSWFY   50
YMR101C_UC5   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_UWOPS05_217_3   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_VL3   
   --------------------------------------------------   
YMR101C_Vin13   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFXWVMSLSLFSWFY   50
YMR101C_W303   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_X2180-1A   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_Y55   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_YJM339   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSTFQRVFAWVMSLSLFSWFY   50
YMR101C_YJM789   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_YPH499   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_YPS128   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_YPS163   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_YS9   1   MKIPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
YMR101C_ZTW1   1   MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFY   50
         

YMR101C_S288C   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_AWRI1631   1   -----------------------MDGNRRYAKSRRLPVKKGHEAGGLTLL   27
YMR101C_AWRI796   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_BC187   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_BY4741   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_BY4742   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_CEN.PK   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_D273-10B   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_DBVPG6044   51   VNFQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_EC1118   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_FL100   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_FY1679   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_FostersB   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_FostersO   51   VNLQNILIKXLRVGXVXEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLXLL   100
YMR101C_JAY291   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_JK9-3d   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_K11   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_Kyokai7   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_L1528   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_LalvinQA23   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_RM11-1a   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_RedStar   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_SEY6210   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_SK1   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_T7   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_T73   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_UC5   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_UWOPS05_217_3   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_VL3   
   --------------------------------------------------   
YMR101C_Vin13   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_W303   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_X2180-1A   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_Y55   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_YJM339   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_YJM789   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_YPH499   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_YPS128   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_YPS163   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_YS9   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
YMR101C_ZTW1   51   VNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLL   100
         

YMR101C_S288C   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_AWRI1631   28   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   77
YMR101C_AWRI796   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_BC187   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_BY4741   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_BY4742   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_CEN.PK   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEVVDTLMNLFTVKLDEFAKRAK   150
YMR101C_D273-10B   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_DBVPG6044   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_EC1118   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_FL100   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_FY1679   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_FostersB   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_FostersO   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_JAY291   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_JK9-3d   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_K11   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_Kyokai7   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_L1528   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_LalvinQA23   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_RM11-1a   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_RedStar   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_SEY6210   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_SK1   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_T7   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_T73   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRTK   150
YMR101C_UC5   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_UWOPS05_217_3   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_VL3   1   ------------------------------------------MNSQKRAK   8
YMR101C_Vin13   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_W303   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_X2180-1A   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_Y55   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_YJM339   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_YJM789   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_YPH499   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_YPS128   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_YPS163   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
YMR101C_YS9   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEVVDTLMNLFTVKLDEFAKRAK   150
YMR101C_ZTW1   101   TLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAK   150
         

YMR101C_S288C   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_AWRI1631   78   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   126
YMR101C_AWRI796   151   DYKDPLYGSKIRIVGDQSLLSPRNERKKLKRWKKSHRMETISLYLYVFLT   200
YMR101C_BC187   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_BY4741   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_BY4742   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_CEN.PK   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_D273-10B   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_DBVPG6044   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_EC1118   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_FL100   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_FY1679   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_FostersB   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKGGRNHTGWRRFHFIYMFSL   199
YMR101C_FostersO   151   DYKDPLYGSKIRIVGDQSLLSPEMKKKKLKRWKKSHRMETISLYLYCFPY   200
YMR101C_JAY291   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_JK9-3d   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_K11   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_Kyokai7   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_L1528   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_LalvinQA23   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_RM11-1a   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_RedStar   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_SEY6210   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_SK1   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_T7   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_T73   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_UC5   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_UWOPS05_217_3   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_VL3   9   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   57
YMR101C_Vin13   151   DYKDPLYGSKIRIVGDQSLLSPEMK-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_W303   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_X2180-1A   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_Y55   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_YJM339   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_YJM789   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_YPH499   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_YPS128   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_YPS163   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_YS9   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
YMR101C_ZTW1   151   DYKDPLYGSKIRIVGDQSLLSPEMR-KKIKKVEEITQDGDDFTLFICFPY   199
         

YMR101C_S288C   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_AWRI1631   127   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   176
YMR101C_AWRI796   201   LQEMICYILFVIQLKTIWKINHQGLI------------------------   226
YMR101C_BC187   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_BY4741   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_BY4742   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_CEN.PK   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_D273-10B   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_DBVPG6044   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_EC1118   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_FL100   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_FY1679   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_FostersB   200   HFKK----------------------------------------------   203
YMR101C_FostersO   201   TSRNDMLHTIRDSVEDHLEK------------------------------   220
YMR101C_JAY291   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_JK9-3d   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_K11   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_Kyokai7   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_L1528   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_LalvinQA23   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_RM11-1a   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_RedStar   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_SEY6210   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_SK1   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_T7   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_T73   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_UC5   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_UWOPS05_217_3   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFYSNKCELLIRTS   249
YMR101C_VL3   58   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   107
YMR101C_Vin13   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_W303   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_X2180-1A   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_Y55   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_YJM339   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_YJM789   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_YPH499   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_YPS128   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_YPS163   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_YS9   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
YMR101C_ZTW1   200   TSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTS   249
         

YMR101C_S288C   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_AWRI1631   177   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   226
YMR101C_AWRI796   
   --------------------------------------------------   
YMR101C_BC187   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_BY4741   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_BY4742   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_CEN.PK   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_D273-10B   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_DBVPG6044   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_EC1118   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_FL100   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_FY1679   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_FostersB   
   --------------------------------------------------   
YMR101C_FostersO   
   --------------------------------------------------   
YMR101C_JAY291   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_JK9-3d   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_K11   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_Kyokai7   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_L1528   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_LalvinQA23   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_RM11-1a   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_RedStar   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_SEY6210   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_SK1   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_T7   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_T73   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_UC5   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_UWOPS05_217_3   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_VL3   108   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   157
YMR101C_Vin13   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_W303   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_X2180-1A   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_Y55   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_YJM339   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_YJM789   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_YPH499   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_YPS128   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_YPS163   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_YS9   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
YMR101C_ZTW1   250   GHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKY   299
         

YMR101C_S288C   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_AWRI1631   227   NEKNHSLFEKIHESVPSIFKKRKQLCHCTTFQTP-HFSFGYRR-   268
YMR101C_AWRI796   
   --------------------------------------------   
YMR101C_BC187   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_BY4741   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_BY4742   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_CEN.PK   300   NEKNHSLFEKIHESVPSIFKKKKTAMLLYNFPNPPISVSVTGDE   343
YMR101C_D273-10B   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_DBVPG6044   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLCNFPNPPISVSVTGDE   343
YMR101C_EC1118   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_FL100   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_FY1679   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_FostersB   
   --------------------------------------------   
YMR101C_FostersO   
   --------------------------------------------   
YMR101C_JAY291   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_JK9-3d   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_K11   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_Kyokai7   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_L1528   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_LalvinQA23   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPXFSFGYRR-   342
YMR101C_RM11-1a   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_RedStar   300   NEKNHSLFEKIHESVPSIFKKKKTAMLLYNFPNPPISVSVTGDE   343
YMR101C_SEY6210   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_SK1   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_T7   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_T73   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_UC5   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_UWOPS05_217_3   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_VL3   158   NEKNHSLFEKIHESVPSIFKKXETAMSLYNFPNPPISVSVTGDE   201
YMR101C_Vin13   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_W303   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_X2180-1A   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_Y55   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_YJM339   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_YJM789   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_YPH499   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_YPS128   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_YPS163   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE   343
YMR101C_YS9   300   NEKNHSLFEKIHESVPSIFKKKKTAMLLYNFPNPPISVSVTGDE   343
YMR101C_ZTW1   300   NEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPHFSFGYRR-   342
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YMR101C_S288C from SGD:

YMR101C_S288C [source=SGD]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_AWRI1631 from AWRI:

YMR101C_AWRI1631 [source=AWRI]  Length: 269  Wed Feb 21 19:10:34 2018  Type: P  Check: 9290  ..

       1  MDGNRRYAKS RRLPVKKGHE AGGLTLLTLL YICKRLGVKC VSAYAFSIEN

      51  FNRPKEEVDT LMNLFTVKLD EFAKRAKDYK DPLYGSKIRI VGDQSLLSPE

     101  MRKKIKKVEE ITQDGDDFTL FICFPYTSRN DMLHTIRDSV EDHLENKSPR

     151  INIRKFTNKM YMGFHSNKCE LLIRTSGHRR LSDYMLWQVH ENATIEFSDT

     201  LWPNFSFFAM YLMILKWSFF STIQKYNEKN HSLFEKIHES VPSIFKKRKQ

     251  LCHCTTFQTP HFSFGYRR*

Protein Sequence for YMR101C_AWRI796 from AWRI:

YMR101C_AWRI796 [source=AWRI]  Length: 227  Wed Feb 21 19:10:34 2018  Type: P  Check: 2671  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPRNERKKLK RWKKSHRMET ISLYLYVFLT

     201  LQEMICYILF VIQLKTIWKI NHQGLI*

Protein Sequence for YMR101C_BC187 from Stanford:

YMR101C_BC187 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_BY4741 from Stanford:

YMR101C_BY4741 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_BY4742 from Stanford:

YMR101C_BY4742 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_CEN.PK from Stanford:

YMR101C_CEN.PK [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2729  ..

       1  MKIPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEV VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMLLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_D273-10B from Stanford:

YMR101C_D273-10B [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_DBVPG6044 from Stanford:

YMR101C_DBVPG6044 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 1492  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNFQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLCNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_EC1118 from Genoscope:

YMR101C_EC1118 [source=Genoscope]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2908  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFEWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_FL100 from Stanford:

YMR101C_FL100 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_FY1679 from Stanford:

YMR101C_FY1679 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_FostersB from AWRI:

YMR101C_FostersB [source=AWRI]  Length: 204  Wed Feb 21 19:10:34 2018  Type: P  Check: 2994  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK GGRNHTGWRR FHFIYMFSLH

     201  FKK*

Protein Sequence for YMR101C_FostersO from AWRI:

YMR101C_FostersO [source=AWRI]  Length: 221  Wed Feb 21 19:10:34 2018  Type: P  Check: 8202  ..

       1  MKMPSXIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKX LRVGXVXEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLXLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMKKKKLK RWKKSHRMET ISLYLYCFPY

     201  TSRNDMLHTI RDSVEDHLEK *

Protein Sequence for YMR101C_JAY291 from Duke:

YMR101C_JAY291 [source=Duke]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_JK9-3d from Stanford:

YMR101C_JK9-3d [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_K11 from Stanford:

YMR101C_K11 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_Kyokai7 from NRIB:

YMR101C_Kyokai7 [source=NRIB]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_L1528 from Stanford:

YMR101C_L1528 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_LalvinQA23 from AWRI:

YMR101C_LalvinQA23 [source=AWRI]  Length: 343  Wed Feb 21 19:10:34 2018  Type: P  Check: 3640  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFXWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPXFSFGY RR*


Protein Sequence for YMR101C_RM11-1a from Stanford:

YMR101C_RM11-1a [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_RedStar from Stanford:

YMR101C_RedStar [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2469  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMLLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_SEY6210 from Stanford:

YMR101C_SEY6210 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_SK1 from Stanford:

YMR101C_SK1 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_T7 from WashU:

YMR101C_T7 [source=WashU]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_T73 from WashU:

YMR101C_T73 [source=WashU]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 3573  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFEWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRTK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_UC5 from WashU:

YMR101C_UC5 [source=WashU]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_UWOPS05_217_3 from Stanford:

YMR101C_UWOPS05_217_3 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2926  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFYSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_VL3 from AWRI:

YMR101C_VL3 [source=AWRI]  Length: 202  Wed Feb 21 19:10:34 2018  Type: P  Check: 4805  ..

       1  MNSQKRAKDY KDPLYGSKIR IVGDQSLLSP EMRKKIKKVE EITQDGDDFT

      51  LFICFPYTSR NDMLHTIRDS VEDHLENKSP RINIRKFTNK MYMGFHSNKC

     101  ELLIRTSGHR RLSDYMLWQV HENATIEFSD TLWPNFSFFA MYLMILKWSF

     151  FSTIQKYNEK NHSLFEKIHE SVPSIFKKXE TAMSLYNFPN PPISVSVTGD

     201  E*

Protein Sequence for YMR101C_Vin13 from AWRI:

YMR101C_Vin13 [source=AWRI]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 3602  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFXWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMKKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_W303 from Stanford:

YMR101C_W303 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_X2180-1A from Stanford:

YMR101C_X2180-1A [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_Y55 from Stanford:

YMR101C_Y55 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_YJM339 from Stanford:

YMR101C_YJM339 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 3108  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK STFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_YJM789 from Stanford:

YMR101C_YJM789 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_YPH499 from Stanford:

YMR101C_YPH499 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_YPS128 from Stanford:

YMR101C_YPS128 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_YPS163 from Stanford:

YMR101C_YPS163 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2756  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_YS9 from Stanford:

YMR101C_YS9 [source=Stanford]  Length: 344  Wed Feb 21 19:10:34 2018  Type: P  Check: 2729  ..

       1  MKIPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEV VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMLLYNF PNPPISVSVT GDE*


Protein Sequence for YMR101C_ZTW1 from Zhejiang:

YMR101C_ZTW1 [source=Zhejiang]  Length: 343  Wed Feb 21 19:10:34 2018  Type: P  Check: 1966  ..

       1  MKMPSIIQIQ FVALKRLLVE TKEQMCFAVK SIFQRVFAWV MSLSLFSWFY

      51  VNLQNILIKA LRVGPVPEHV SFIMDGNRRY AKSRRLPVKK GHEAGGLTLL

     101  TLLYICKRLG VKCVSAYAFS IENFNRPKEE VDTLMNLFTV KLDEFAKRAK

     151  DYKDPLYGSK IRIVGDQSLL SPEMRKKIKK VEEITQDGDD FTLFICFPYT

     201  SRNDMLHTIR DSVEDHLENK SPRINIRKFT NKMYMGFHSN KCELLIRTSG

     251  HRRLSDYMLW QVHENATIEF SDTLWPNFSF FAMYLMILKW SFFSTIQKYN

     301  EKNHSLFEKI HESVPSIFKK KKTAMSLYNF PNPPHFSFGY RR*