MSN2/YMR037C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YMR037C_S288C   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_AWRI1631   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_AWRI796   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_BC187   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_BY4741   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_BY4742   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_CBS7960   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_CEN.PK   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_CLIB215   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_D273-10B   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_DBVPG6044   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_EC1118   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_EC9-8   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNSINNDVIPYSLDIKNTVLD   50
YMR037C_FL100   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_FY1679   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_FostersB   
   --------------------------------------------------   
YMR037C_FostersO   
   --------------------------------------------------   
YMR037C_JAY291   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_JK9-3d   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_K11   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNSINNDVIPYSLDIKNTVLD   50
YMR037C_Kyokai7   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_L1528   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_LalvinQA23   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_M22   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_PW5   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_RM11-1a   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_RedStar   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_SEY6210   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_SK1   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_T7   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_UC5   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNSINNDVIPYSLDIKNTVLD   50
YMR037C_UWOPS05_217_3   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_VL3   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_Vin13   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_W303   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_X2180-1A   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_Y55   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_YJM269   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_YJM339   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_YJM789   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_YPH499   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_YPS128   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_YPS163   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_YS9   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
YMR037C_ZTW1   1   MTVDHDFNSEDILFPIESMSSIQYVENNNPNNINNDVIPYSLDIKNTVLD   50
         

YMR037C_S288C   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_AWRI1631   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_AWRI796   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_BC187   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_BY4741   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_BY4742   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_CBS7960   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_CEN.PK   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_CLIB215   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_D273-10B   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_DBVPG6044   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_EC1118   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_EC9-8   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_FL100   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_FY1679   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_FostersB   
   --------------------------------------------------   
YMR037C_FostersO   
   --------------------------------------------------   
YMR037C_JAY291   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_JK9-3d   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_K11   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_Kyokai7   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_L1528   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_LalvinQA23   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_M22   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_PW5   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_RM11-1a   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_RedStar   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_SEY6210   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_SK1   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_T7   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_UC5   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_UWOPS05_217_3   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_VL3   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_Vin13   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_W303   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_X2180-1A   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_Y55   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_YJM269   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_YJM339   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_YJM789   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_YPH499   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_YPS128   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_YPS163   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_YS9   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
YMR037C_ZTW1   51   SADLNDIQNQETSLNLGLPPLSFDSPLPVTETIPSTTDNSLHLKADSNKN   100
         

YMR037C_S288C   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_AWRI1631   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_AWRI796   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_BC187   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_BY4741   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_BY4742   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_CBS7960   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_CEN.PK   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_CLIB215   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_D273-10B   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_DBVPG6044   101   RDARTIENDSEIKSTNNANGPGANQYTTLTSHYPMNDILYNMNNPLQSPS   150
YMR037C_EC1118   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_EC9-8   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_FL100   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_FY1679   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_FostersB   1   ----------------------------------MNDILYNMNNPLQSPS   16
YMR037C_FostersO   
   --------------------------------------------------   
YMR037C_JAY291   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_JK9-3d   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_K11   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_Kyokai7   101   RDTRTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_L1528   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_LalvinQA23   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_M22   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_PW5   101   RDARTIENDSEIKSTNNANGPGANQYTTLTSHYPMNDILYNMNNPLQSPS   150
YMR037C_RM11-1a   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_RedStar   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_SEY6210   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_SK1   101   RDARTIENDSEIKSTNNANGPGANQYTTLTSHYPMNDILYNMNNPLQSPS   150
YMR037C_T7   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_UC5   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_UWOPS05_217_3   101   RDVRTIENDSEIKSTNNANGPGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_VL3   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_Vin13   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_W303   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_X2180-1A   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_Y55   101   RDARTIENDSEIKSTNNANGPGANQYTTLTSHYPMNDILYNMNNPLQSPS   150
YMR037C_YJM269   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_YJM339   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_YJM789   101   RDARTIENDSEIKSTNNANGPGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_YPH499   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_YPS128   101   RDARTIENDSEIKSTNNANGPGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_YPS163   101   RDARTIENDSEIKSTNNANGPGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_YS9   101   RDARTIENDSEIKSTNNASGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
YMR037C_ZTW1   101   RDARTIENDSEIKSTNNANGSGANQYTTLTSPYPMNDILYNMNNPLQSPS   150
         

YMR037C_S288C   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_AWRI1631   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_AWRI796   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_BC187   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_BY4741   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_BY4742   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_CBS7960   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_CEN.PK   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_CLIB215   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_D273-10B   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_DBVPG6044   151   PSSVPPNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_EC1118   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_EC9-8   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_FL100   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_FY1679   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_FostersB   17   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   66
YMR037C_FostersO   
   --------------------------------------------------   
YMR037C_JAY291   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_JK9-3d   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_K11   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_Kyokai7   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_L1528   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_LalvinQA23   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_M22   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_PW5   151   PSSVPPNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_RM11-1a   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_RedStar   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_SEY6210   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_SK1   151   PSSVPPNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_T7   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_UC5   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_UWOPS05_217_3   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTPIKDNRL   200
YMR037C_VL3   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_Vin13   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_W303   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_X2180-1A   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_Y55   151   PSSVPPNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_YJM269   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_YJM339   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_YJM789   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_YPH499   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_YPS128   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_YPS163   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_YS9   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
YMR037C_ZTW1   151   PSSVPQNPTINPPINTASNETNLSPQTSNGNETLISPRAQQHTSIKDNRL   200
         

YMR037C_S288C   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_AWRI1631   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_AWRI796   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_BC187   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_BY4741   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_BY4742   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_CBS7960   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_CEN.PK   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_CLIB215   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_D273-10B   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_DBVPG6044   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSGTNSYSNSISNSNSNSTGNLN   250
YMR037C_EC1118   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_EC9-8   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_FL100   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_FY1679   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_FostersB   67   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNPNSTGNLN   116
YMR037C_FostersO   
   --------------------------------------------------   
YMR037C_JAY291   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_JK9-3d   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_K11   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_Kyokai7   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_L1528   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_LalvinQA23   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_M22   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_PW5   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSGTNSYSNSISNSNSNSTGNLN   250
YMR037C_RM11-1a   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_RedStar   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_SEY6210   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_SK1   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSGTNSYSNSISNSNSNSTGNLN   250
YMR037C_T7   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_UC5   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_UWOPS05_217_3   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_VL3   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_Vin13   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_W303   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_X2180-1A   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_Y55   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSGTNSYSNSISNSNSNSTGNLN   250
YMR037C_YJM269   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_YJM339   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_YJM789   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_YPH499   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_YPS128   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_YPS163   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_YS9   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
YMR037C_ZTW1   201   SLPNGANSNLFIDTNPNNLNEKLRNQLNSDTNSYSNSISNSNSNSTGNLN   250
         

YMR037C_S288C   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_AWRI1631   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_AWRI796   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_BC187   251   SSYFNSMNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_BY4741   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_BY4742   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_CBS7960   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_CEN.PK   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_CLIB215   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_D273-10B   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_DBVPG6044   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_EC1118   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_EC9-8   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_FL100   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDDTNLSRRRFSDVITNQFPSMT   300
YMR037C_FY1679   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_FostersB   117   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   165
YMR037C_FostersO   
   --------------------------------------------------   
YMR037C_JAY291   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_JK9-3d   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_K11   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_Kyokai7   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_L1528   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_LalvinQA23   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_M22   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_PW5   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_RM11-1a   251   SSYFNSMNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_RedStar   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_SEY6210   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_SK1   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_T7   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_UC5   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_UWOPS05_217_3   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_VL3   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_Vin13   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_W303   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_X2180-1A   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_Y55   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_YJM269   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_YJM339   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_YJM789   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_YPH499   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_YPS128   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_YPS163   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_YS9   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
YMR037C_ZTW1   251   SSYFNSLNIDSMLDDYVSSDLLLNDDDDDTN-LSRRRFSDVITNQFPSMT   299
         

YMR037C_S288C   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_AWRI1631   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_AWRI796   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_BC187   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_BY4741   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_BY4742   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_CBS7960   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_CEN.PK   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_CLIB215   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_D273-10B   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_DBVPG6044   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_EC1118   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_EC9-8   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_FL100   301   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   350
YMR037C_FY1679   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_FostersB   166   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   215
YMR037C_FostersO   1   ------------------------------------------------MQ   2
YMR037C_JAY291   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_JK9-3d   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_K11   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_Kyokai7   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_L1528   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_LalvinQA23   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_M22   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_PW5   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_RM11-1a   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_RedStar   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_SEY6210   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_SK1   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_T7   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_UC5   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_UWOPS05_217_3   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSISSSNASPNTTTMNANA   349
YMR037C_VL3   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_Vin13   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_W303   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_X2180-1A   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_Y55   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_YJM269   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_YJM339   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_YJM789   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_YPH499   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_YPS128   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_YPS163   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_YS9   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANA   349
YMR037C_ZTW1   300   NSRNSISHSLDLWNHPKINPSNRNTNLNITTNSTSSSNASPNTTTMNANT   349
         

YMR037C_S288C   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_AWRI1631   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_AWRI796   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_BC187   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_BY4741   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_BY4742   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_CBS7960   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_CEN.PK   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_CLIB215   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_D273-10B   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_DBVPG6044   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_EC1118   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_EC9-8   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_FL100   351   DSNIAGNPKNNDTTIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   400
YMR037C_FY1679   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_FostersB   216   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   265
YMR037C_FostersO   3   TQILLANPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   52
YMR037C_JAY291   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_JK9-3d   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_K11   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_Kyokai7   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_L1528   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_LalvinQA23   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_M22   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_PW5   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_RM11-1a   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_RedStar   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_SEY6210   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_SK1   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_T7   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_UC5   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_UWOPS05_217_3   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_VL3   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_Vin13   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_W303   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_X2180-1A   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_Y55   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_YJM269   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_YJM339   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_YJM789   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_YPH499   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_YPS128   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_YPS163   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_YS9   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
YMR037C_ZTW1   350   DSNIAGNPKNNDATIDNELTQILNEYNMNFNDNLGTSTSGKNKSACPSSF   399
         

YMR037C_S288C   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_AWRI1631   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_AWRI796   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_BC187   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_BY4741   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_BY4742   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_CBS7960   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_CEN.PK   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_CLIB215   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_D273-10B   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_DBVPG6044   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_EC1118   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_EC9-8   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_FL100   401   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   450
YMR037C_FY1679   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_FostersB   266   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNVKSFNSDLYSRRQR   315
YMR037C_FostersO   53   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNXKSFNSDLYSRRQR   102
YMR037C_JAY291   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_JK9-3d   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_K11   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_Kyokai7   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_L1528   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_LalvinQA23   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_M22   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_PW5   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_RM11-1a   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_RedStar   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_SEY6210   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_SK1   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_T7   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_UC5   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_UWOPS05_217_3   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_VL3   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_Vin13   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_W303   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_X2180-1A   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_Y55   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_YJM269   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_YJM339   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_YJM789   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_YPH499   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_YPS128   400   DANAMTKINPSQQLQQQLSRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_YPS163   400   DANAMTKINPSQQLQQQLSRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_YS9   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
YMR037C_ZTW1   400   DANAMTKINPSQQLQQQLNRVQHKQLTSSHNNSSTNMKSFNSDLYSRRQR   449
         

YMR037C_S288C   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_AWRI1631   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_AWRI796   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_BC187   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_BY4741   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_BY4742   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_CBS7960   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_CEN.PK   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_CLIB215   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_D273-10B   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_DBVPG6044   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_EC1118   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_EC9-8   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_FL100   451   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   500
YMR037C_FY1679   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_FostersB   316   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   365
YMR037C_FostersO   103   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSXNAS   152
YMR037C_JAY291   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_JK9-3d   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_K11   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_Kyokai7   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_L1528   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_LalvinQA23   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_M22   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_PW5   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_RM11-1a   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_RedStar   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_SEY6210   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_SK1   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_T7   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_UC5   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_UWOPS05_217_3   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_VL3   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_Vin13   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_W303   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_X2180-1A   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_Y55   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_YJM269   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_YJM339   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_YJM789   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_YPH499   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_YPS128   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_YPS163   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_YS9   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
YMR037C_ZTW1   450   ASLPIIDDSLSYDLVNKQDEDPKNDMLPNSNLSSSQQFIKPSMILSDNAS   499
         

YMR037C_S288C   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_AWRI1631   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_AWRI796   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_BC187   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_BY4741   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_BY4742   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_CBS7960   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_CEN.PK   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_CLIB215   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITSNEYGSIIACIIIL   549
YMR037C_D273-10B   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_DBVPG6044   500   VIAKVATTGLSNDMPFLTEKGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_EC1118   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_EC9-8   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_FL100   501   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   550
YMR037C_FY1679   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_FostersB   366   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   415
YMR037C_FostersO   153   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   202
YMR037C_JAY291   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_JK9-3d   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_K11   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_Kyokai7   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_L1528   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_LalvinQA23   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_M22   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_PW5   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_RM11-1a   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_RedStar   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_SEY6210   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_SK1   500   VIAKVATTGLSNDMPFLTEKGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_T7   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_UC5   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPNFDLSITQMNMAPLSPASSSS   549
YMR037C_UWOPS05_217_3   500   VIAKVATTGLSNDMPFLTEEGEQNANSTPIFDLSITQMNMAPLSPASSS</