ORC1/YML065W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YML065W_S288C   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_AWRI1631   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_AWRI796   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_BC187   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_BY4741   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_BY4742   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_CBS7960   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_CEN.PK   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_CLIB215   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_CLIB324   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_D273-10B   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_DBVPG6044   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_EC1118   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_EC9-8   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_FL100   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_FY1679   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_FostersB   
   --------------------------------------------------   
YML065W_FostersO   
   --------------------------------------------------   
YML065W_JAY291   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_JK9-3d   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_K11   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_Kyokai7   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_L1528   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_RM11-1a   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_RedStar   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_SEY6210   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_SK1   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_T7   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_UC5   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_UWOPS05_217_3   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_VL3   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_Vin13   
   --------------------------------------------------   
YML065W_W303   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_X2180-1A   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_Y55   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_YJM269   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_YJM339   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_YJM789   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_YPH499   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_YPS128   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_YPS163   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_YS9   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
YML065W_ZTW1   1   MAKTLKDLQGWEIITTDEQGNIIDGGQKRLRRRGAKTEHYLKRSSDGIKL   50
         

YML065W_S288C   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_AWRI1631   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_AWRI796   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_BC187   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_BY4741   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_BY4742   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_CBS7960   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_CEN.PK   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_CLIB215   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_CLIB324   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_D273-10B   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_DBVPG6044   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_EC1118   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_EC9-8   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_FL100   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_FY1679   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_FostersB   1   -------MHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   43
YML065W_FostersO   
   --------------------------------------------------   
YML065W_JAY291   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_JK9-3d   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_K11   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_Kyokai7   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_L1528   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_RM11-1a   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_RedStar   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_SEY6210   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_SK1   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_T7   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_UC5   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_UWOPS05_217_3   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_VL3   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_Vin13   
   --------------------------------------------------   
YML065W_W303   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_X2180-1A   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_Y55   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_YJM269   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_YJM339   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_YJM789   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_YPH499   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_YPS128   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_YPS163   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_YS9   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
YML065W_ZTW1   51   GRGDSVVMHNEAAGTYSVYMIQELRLNTLNNVVELWALTYLRWFEVNPLA   100
         

YML065W_S288C   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_AWRI1631   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_AWRI796   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_BC187   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_BY4741   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_BY4742   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_CBS7960   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_CEN.PK   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_CLIB215   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_CLIB324   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_D273-10B   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_DBVPG6044   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_EC1118   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_EC9-8   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_FL100   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_FY1679   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_FostersB   44   HYRQFNPDANILNRPLNYYNKXFSETANKNELYLTAELAELQLFNFIRVA   93
YML065W_FostersO   
   --------------------------------------------------   
YML065W_JAY291   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_JK9-3d   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_K11   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_Kyokai7   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_L1528   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_RM11-1a   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_RedStar   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_SEY6210   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_SK1   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_T7   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_UC5   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_UWOPS05_217_3   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_VL3   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_Vin13   
   --------------------------------------------------   
YML065W_W303   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_X2180-1A   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_Y55   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_YJM269   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_YJM339   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_YJM789   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_YPH499   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_YPS128   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_YPS163   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_YS9   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
YML065W_ZTW1   101   HYRQFNPDANILNRPLNYYNKLFSETANKNELYLTAELAELQLFNFIRVA   150
         

YML065W_S288C   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_AWRI1631   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_AWRI796   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_BC187   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_BY4741   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_BY4742   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_CBS7960   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_CEN.PK   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_CLIB215   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_CLIB324   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_D273-10B   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_DBVPG6044   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_EC1118   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_EC9-8   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_FL100   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_FY1679   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_FostersB   94   NVMDGSKWEVLKGNXDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   143
YML065W_FostersO   
   --------------------------------------------------   
YML065W_JAY291   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_JK9-3d   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_K11   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_Kyokai7   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_L1528   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_RM11-1a   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_RedStar   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_SEY6210   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_SK1   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_T7   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_UC5   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_UWOPS05_217_3   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_VL3   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTXEKFVDINIEDVKAYIKKVE   200
YML065W_Vin13   
   --------------------------------------------------   
YML065W_W303   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_X2180-1A   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_Y55   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_YJM269   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_YJM339   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_YJM789   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_YPH499   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_YPS128   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_YPS163   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_YS9   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
YML065W_ZTW1   151   NVMDGSKWEVLKGNVDPERDFTVRYICEPTGEKFVDINIEDVKAYIKKVE   200
         

YML065W_S288C   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_AWRI1631   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_AWRI796   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_BC187   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_BY4741   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_BY4742   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_CBS7960   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_CEN.PK   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_CLIB215   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_CLIB324   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_D273-10B   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_DBVPG6044   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_EC1118   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_EC9-8   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_FL100   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_FY1679   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_FostersB   144   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   193
YML065W_FostersO   
   --------------------------------------------------   
YML065W_JAY291   201   PREAQEYLKDLTLPSKKKEVKRGPQKKDKATQTAQISDAETRATDLTDNE   250
YML065W_JK9-3d   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_K11   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQIPDAETRATDITDNE   250
YML065W_Kyokai7   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_L1528   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_RM11-1a   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_RedStar   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_SEY6210   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_SK1   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_T7   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_UC5   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_UWOPS05_217_3   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_VL3   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_Vin13   
   --------------------------------------------------   
YML065W_W303   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_X2180-1A   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_Y55   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_YJM269   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_YJM339   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_YJM789   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_YPH499   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_YPS128   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_YPS163   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_YS9   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
YML065W_ZTW1   201   PREAQEYLKDLTLPSKKKEIKRGPQKKDKATQTAQISDAETRATDITDNE   250
         

YML065W_S288C   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_AWRI1631   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_AWRI796   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_BC187   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_BY4741   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_BY4742   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_CBS7960   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDED-----EEEDEDEE   295
YML065W_CEN.PK   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDEEE-DEDEEEDEDEE   299
YML065W_CLIB215   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEE-----DEDEEEDEDEE   295
YML065W_CLIB324   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDED-----EEEDEDEE   295
YML065W_D273-10B   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_DBVPG6044   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDEEE-DEDEEEDEDEE   299
YML065W_EC1118   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEE-----DEDEEEDEDEE   295
YML065W_EC9-8   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_FL100   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEE-----DEDEEEDEDEE   295
YML065W_FY1679   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_FostersB   194   DGNEDESSNYESPSDIDVSEDMDSGEISADELEE-----DEDEEEDEDEE   238
YML065W_FostersO   
   --------------------------------------------------   
YML065W_JAY291   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDED-----EEEDEDEE   295
YML065W_JK9-3d   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_K11   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEEEEEEDEDEEEDEDEE   300
YML065W_Kyokai7   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEEEEEEDEDEEEDEDEE   300
YML065W_L1528   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDEEE-DEDEEEDEDEE   299
YML065W_RM11-1a   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEE-----DEDEEEDEDEE   295
YML065W_RedStar   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_SEY6210   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_SK1   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_T7   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEEEEEEDEDEEEDEDEE   300
YML065W_UC5   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEEEEEEDEDEEEDEDEE   300
YML065W_UWOPS05_217_3   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEEE------EEEDEDEE   294
YML065W_VL3   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_Vin13   
   --------------------------------------------------   
YML065W_W303   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_X2180-1A   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_Y55   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDEEE-DEDEEEDEDEE   299
YML065W_YJM269   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_YJM339   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEE-----DEDEEEDEDEE   295
YML065W_YJM789   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_YPH499   251   DGNEDESSDYESPSDIDVSEDMDSGEISADELEEEED-----EEEDEDEE   295
YML065W_YPS128   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDEEE-DEDEEEDEDEE   299
YML065W_YPS163   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDEEE-DEDEEEDEDEE   299
YML065W_YS9   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEDE-----DEEEDEDEE   295
YML065W_ZTW1   251   DGNEDESSNYESPSDIDVSEDMDSGEISADELEEEEEEEDEDEEEDEDEE   300
         

YML065W_S288C   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_AWRI1631   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_AWRI796   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_BC187   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_BY4741   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_BY4742   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_CBS7960   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_CEN.PK   300   EKEARHTNSPRKRRRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   349
YML065W_CLIB215   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_CLIB324   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_D273-10B   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_DBVPG6044   300   EKEARHTNSPRKRRRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   349
YML065W_EC1118   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_EC9-8   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_FL100   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_FY1679   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_FostersB   239   EKEARHTNSPRXRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   288
YML065W_FostersO   1   ---------------------MILTLLYNLPPKKRGRKPKDPSKPRQMLL   29
YML065W_JAY291   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_JK9-3d   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_K11   301   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   350
YML065W_Kyokai7   301   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   350
YML065W_L1528   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   300   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   349
YML065W_RM11-1a   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_RedStar   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_SEY6210   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_SK1   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_T7   301   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   350
YML065W_UC5   301   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   350
YML065W_UWOPS05_217_3   295   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   344
YML065W_VL3   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_Vin13   1   -----------------------------------------------MLL   3
YML065W_W303   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_X2180-1A   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_Y55   300   EKEARHTNSPRKRRRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   349
YML065W_YJM269   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_YJM339   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_YJM789   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_YPH499   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_YPS128   300   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   349
YML065W_YPS163   300   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   349
YML065W_YS9   296   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   345
YML065W_ZTW1   301   EKEARHTNSPRKRGRKIKLGKDDIDASVQPPPKKRGRKPKDPSKPRQMLL   350
         

YML065W_S288C   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_AWRI1631   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_AWRI796   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_BC187   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSISAIPDLTSLPEFY   395
YML065W_BY4741   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_BY4742   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_CBS7960   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_CEN.PK   350   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   399
YML065W_CLIB215   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_CLIB324   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_D273-10B   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_DBVPG6044   350   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   399
YML065W_EC1118   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_EC9-8   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_FL100   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_FY1679   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_FostersB   289   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   338
YML065W_FostersO   30   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   79
YML065W_JAY291   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_JK9-3d   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_K11   351   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   400
YML065W_Kyokai7   351   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   400
YML065W_L1528   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   350   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   399
YML065W_RM11-1a   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_RedStar   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_SEY6210   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_SK1   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_T7   351   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   400
YML065W_UC5   351   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   400
YML065W_UWOPS05_217_3   345   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   394
YML065W_VL3   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_Vin13   4   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   53
YML065W_W303   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_X2180-1A   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_Y55   350   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   399
YML065W_YJM269   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_YJM339   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_YJM789   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_YPH499   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_YPS128   350   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   399
YML065W_YPS163   350   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   399
YML065W_YS9   346   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   395
YML065W_ZTW1   351   ISSCRANNTPVIRKFTKKNVARAKKKYTPFSKRFKSIAAIPDLTSLPEFY   400
         

YML065W_S288C   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_AWRI1631   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_AWRI796   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_BC187   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_BY4741   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_BY4742   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_CBS7960   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_CEN.PK   400   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   449
YML065W_CLIB215   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_CLIB324   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_D273-10B   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_DBVPG6044   400   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   449
YML065W_EC1118   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_EC9-8   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_FL100   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_FY1679   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_FostersB   339   GNSSELMASRFENKLKTTQKHQIXETIFSKVKKQLNSSYVKEEILKSANF   388
YML065W_FostersO   80   GNSSELMASRFENKLKXTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   129
YML065W_JAY291   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_JK9-3d   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_K11   401   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   450
YML065W_Kyokai7   401   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   450
YML065W_L1528   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   400   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   449
YML065W_RM11-1a   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_RedStar   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_SEY6210   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_SK1   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_T7   401   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   450
YML065W_UC5   401   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   450
YML065W_UWOPS05_217_3   395   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   444
YML065W_VL3   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_Vin13   54   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   103
YML065W_W303   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_X2180-1A   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_Y55   400   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   449
YML065W_YJM269   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_YJM339   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_YJM789   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_YPH499   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_YPS128   400   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   449
YML065W_YPS163   400   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   449
YML065W_YS9   396   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   445
YML065W_ZTW1   401   GNSSELMASRFENKLKTTQKHQIVETIFSKVKKQLNSSYVKEEILKSANF   450
         

YML065W_S288C   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_AWRI1631   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_AWRI796   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_BC187   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_BY4741   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_BY4742   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_CBS7960   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_CEN.PK   450   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   499
YML065W_CLIB215   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_CLIB324   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_D273-10B   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_DBVPG6044   450   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   499
YML065W_EC1118   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_EC9-8   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_FL100   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_FY1679   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_FostersB   389   QDYLPARENEFASIYLSAYSAIESDSXTTIYVAGTPGVGKTLTVREVVKE   438
YML065W_FostersO   130   QDYLPARENEFASIYLSAYSAIESDSXTTIYVAGTPGVGKTLTVREVVKE   179
YML065W_JAY291   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_JK9-3d   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_K11   451   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   500
YML065W_Kyokai7   451   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   500
YML065W_L1528   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   450   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   499
YML065W_RM11-1a   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_RedStar   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_SEY6210   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_SK1   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_T7   451   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   500
YML065W_UC5   451   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   500
YML065W_UWOPS05_217_3   445   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   494
YML065W_VL3   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_Vin13   104   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   153
YML065W_W303   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_X2180-1A   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_Y55   450   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   499
YML065W_YJM269   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_YJM339   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_YJM789   446   QDYLPARENEFASIHLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_YPH499   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_YPS128   450   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   499
YML065W_YPS163   450   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   499
YML065W_YS9   446   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   495
YML065W_ZTW1   451   QDYLPARENEFASIYLSAYSAIESDSATTIYVAGTPGVGKTLTVREVVKE   500
         

YML065W_S288C   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_AWRI1631   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_AWRI796   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_BC187   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_BY4741   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_BY4742   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_CBS7960   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_CEN.PK   500   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   549
YML065W_CLIB215   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_CLIB324   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_D273-10B   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_DBVPG6044   500   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   549
YML065W_EC1118   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_EC9-8   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_FL100   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_FY1679   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_FostersB   439   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   488
YML065W_FostersO   180   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   229
YML065W_JAY291   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_JK9-3d   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_K11   501   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   550
YML065W_Kyokai7   501   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   550
YML065W_L1528   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_LalvinQA23   
   --------------------------------------------------   
YML065W_PW5   500   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   549
YML065W_RM11-1a   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_RedStar   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_SEY6210   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_SK1   496   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   545
YML065W_T7   501   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   550
YML065W_UC5   501   LLSSSAQREIPDFLYVEINGLKMVKPTDCYETLWNKVSGERLTWAASMES   550
YML065W_UWOPS05_217_3   495   LLSSSAQREIP<