SIR3/YLR442C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YLR442C_S288C   
   --------------------------------------------------   
YLR442C_AWRI796   1   MSSQNKLFYITNADDSTKFQLVNDVMDELITSSARKELPIFDYIHIDALE   50
YLR442C_BC187   
   --------------------------------------------------   
YLR442C_BY4741   
   --------------------------------------------------   
YLR442C_BY4742   
   --------------------------------------------------   
YLR442C_CEN.PK   
   --------------------------------------------------   
YLR442C_CLIB215   
   --------------------------------------------------   
YLR442C_CLIB324   
   --------------------------------------------------   
YLR442C_D273-10B   
   --------------------------------------------------   
YLR442C_DBVPG6044   
   --------------------------------------------------   
YLR442C_EC1118   
   --------------------------------------------------   
YLR442C_EC9-8   
   --------------------------------------------------   
YLR442C_FL100   
   --------------------------------------------------   
YLR442C_FY1679   
   --------------------------------------------------   
YLR442C_FostersB   
   --------------------------------------------------   
YLR442C_FostersO   
   --------------------------------------------------   
YLR442C_JAY291   
   --------------------------------------------------   
YLR442C_JK9-3d   
   --------------------------------------------------   
YLR442C_K11   
   --------------------------------------------------   
YLR442C_Kyokai7   
   --------------------------------------------------   
YLR442C_L1528   
   --------------------------------------------------   
YLR442C_LalvinQA23   
   --------------------------------------------------   
YLR442C_RM11-1a   
   --------------------------------------------------   
YLR442C_RedStar   
   --------------------------------------------------   
YLR442C_SEY6210   
   --------------------------------------------------   
YLR442C_SK1   
   --------------------------------------------------   
YLR442C_T7   
   --------------------------------------------------   
YLR442C_UC5   
   --------------------------------------------------   
YLR442C_UWOPS05_217_3   
   --------------------------------------------------   
YLR442C_VL3   
   --------------------------------------------------   
YLR442C_Vin13   
   --------------------------------------------------   
YLR442C_W303   
   --------------------------------------------------   
YLR442C_X2180-1A   
   --------------------------------------------------   
YLR442C_Y10   
   --------------------------------------------------   
YLR442C_Y55   
   --------------------------------------------------   
YLR442C_YJM269   
   --------------------------------------------------   
YLR442C_YJM339   
   --------------------------------------------------   
YLR442C_YJM789   
   --------------------------------------------------   
YLR442C_YPH499   
   --------------------------------------------------   
YLR442C_YPS128   
   --------------------------------------------------   
YLR442C_YPS163   
   --------------------------------------------------   
YLR442C_YS9   
   --------------------------------------------------   
YLR442C_ZTW1   
   --------------------------------------------------   
         

YLR442C_S288C   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_AWRI796   51   LAGMDALYEKIWFAISKENLCGDISLEALNFYITNVPKAKKRKTLILIQN   100
YLR442C_BC187   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_BY4741   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_BY4742   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_CEN.PK   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_CLIB215   1   ----------------------------------MAKTLKDLDGWQVITT   16
YLR442C_CLIB324   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_D273-10B   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_DBVPG6044   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_EC1118   1   ----------------------------------MAKTLKDLDGWQVITT   16
YLR442C_EC9-8   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_FL100   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_FY1679   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_FostersB   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_FostersO   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_JAY291   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_JK9-3d   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_K11   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_Kyokai7   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_L1528   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_LalvinQA23   1   ----------------------------------MAKTLKDLDGWQVIXT   16
YLR442C_RM11-1a   1   ----------------------------------MAKTLKDLDGWQVITT   16
YLR442C_RedStar   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_SEY6210   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_SK1   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_T7   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_UC5   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_UWOPS05_217_3   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_VL3   1   ----------------------------------MAKTLKDLDGWQVIXT   16
YLR442C_Vin13   1   ----------------------------------MSRKQKKRKTLILIQN   16
YLR442C_W303   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_X2180-1A   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_Y10   1   ----------------------------------MAKTLKDLDGWQVITT   16
YLR442C_Y55   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_YJM269   1   ----------------------------------MAKTLKDLDGWQVITT   16
YLR442C_YJM339   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_YJM789   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_YPH499   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_YPS128   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_YPS163   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_YS9   1   ----------------------------------MAKTLKDLDGWQVIIT   16
YLR442C_ZTW1   1   ----------------------------------MAKTLKDLDGWQVIIT   16
         

YLR442C_S288C   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_AWRI796   101   PDNLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIGEQINIMPTLKAHF   150
YLR442C_BC187   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_BY4741   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_BY4742   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_CEN.PK   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_CLIB215   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_CLIB324   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_D273-10B   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_DBVPG6044   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_EC1118   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_EC9-8   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_FL100   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_FY1679   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_FostersB   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_FostersO   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_JAY291   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_JK9-3d   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_K11   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_Kyokai7   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_L1528   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_LalvinQA23   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_RM11-1a   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_RedStar   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_SEY6210   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_SK1   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_T7   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_UC5   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_UWOPS05_217_3   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_VL3   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_Vin13   17   PDNLLSEKILQYFEKWISSKNSKLSIICVGGHNVTIGEQINIMPTLKAHF   66
YLR442C_W303   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_X2180-1A   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_Y10   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_Y55   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_YJM269   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_YJM339   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_YJM789   17   DDQGRVIDDNNRRRSRKRGGEKVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_YPH499   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_YPS128   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_YPS163   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_YS9   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
YLR442C_ZTW1   17   DDQGRVIDDNNRRRSRKRGGENVFLKRISDGLSFGKGESVIFNDNVTETY   66
         

YLR442C_S288C   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_AWRI796   151   TEIKLNKVNKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIREGQNQ   200
YLR442C_BC187   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_BY4741   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_BY4742   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_CEN.PK   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_CLIB215   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_CLIB324   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_D273-10B   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_DBVPG6044   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_EC1118   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_EC9-8   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_FL100   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_FY1679   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_FostersB   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_FostersO   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_JAY291   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_JK9-3d   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_K11   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_Kyokai7   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_L1528   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_LalvinQA23   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_RM11-1a   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_RedStar   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_SEY6210   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_SK1   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_T7   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_UC5   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_UWOPS05_217_3   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_VL3   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_Vin13   67   TEIKLNKVNKNELQQMIITRLKSLLKPFHVKVNDKKEMTIYNNIREGQNQ   116
YLR442C_W303   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_X2180-1A   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_Y10   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_Y55   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_YJM269   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_YJM339   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_YJM789   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_YPH499   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_YPS128   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_YPS163   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_YS9   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
YLR442C_ZTW1   67   SVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRPDLIKEDHPL   116
         

YLR442C_S288C   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_AWRI796   201   KIPDNVIVINHKIN------------------------------------   214
YLR442C_BC187   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_BY4741   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_BY4742   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_CEN.PK   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_CLIB215   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_CLIB324   117   EFYKDKFFNEVNKSELYLTAELSEICPKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_D273-10B   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKT   166
YLR442C_DBVPG6044   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_EC1118   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_EC9-8   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_FL100   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_FY1679   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_FostersB   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIXVGQILPESQWNDSSIDKI   166
YLR442C_FostersO   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_JAY291   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_JK9-3d   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKT   166
YLR442C_K11   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_Kyokai7   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_L1528   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_LalvinQA23   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_RM11-1a   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_RedStar   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_SEY6210   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_SK1   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_T7   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_UC5   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_UWOPS05_217_3   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_VL3   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_Vin13   117   KIPDNVIVINHKIN------------------------------------   130
YLR442C_W303   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_X2180-1A   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_Y10   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_Y55   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_YJM269   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_YJM339   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_YJM789   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESRWNDSSIDKI   166
YLR442C_YPH499   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_YPS128   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_YPS163   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
YLR442C_YS9   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKT   166
YLR442C_ZTW1   117   EFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKI   166
         

YLR442C_S288C   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_AWRI796   215   -----------------------------------NKITQLIAKNVANVS   229
YLR442C_BC187   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_BY4741   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_BY4742   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_CEN.PK   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_CLIB215   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_CLIB324   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_D273-10B   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_DBVPG6044   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_EC1118   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_EC9-8   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_FL100   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_FY1679   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_FostersB   167   EDRDXLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_FostersO   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_JAY291   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_JK9-3d   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_K11   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_Kyokai7   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_L1528   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_LalvinQA23   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_RM11-1a   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_RedStar   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_SEY6210   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_SK1   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_T7   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_UC5   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_UWOPS05_217_3   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_VL3   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_Vin13   131   -----------------------------------NKITQLIAKNVANVS   145
YLR442C_W303   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_X2180-1A   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_Y10   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_Y55   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_YJM269   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_YJM339   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_YJM789   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_YPH499   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_YPS128   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_YPS163   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_YS9   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
YLR442C_ZTW1   167   EDRDFLVRYACEPTAEKFVPIDIFQIIRRVKEMEPKQSDEYLKRVSVPVS   216
         

YLR442C_S288C   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_AWRI796   230   GSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAINGF   279
YLR442C_BC187   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_BY4741   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_BY4742   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_CEN.PK   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_CLIB215   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_CLIB324   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_D273-10B   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_DBVPG6044   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_EC1118   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_EC9-8   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_FL100   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_FY1679   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_FostersB   217   GQKTNRQXXHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_FostersO   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_JAY291   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_JK9-3d   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_K11   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_Kyokai7   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_L1528   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_LalvinQA23   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_RM11-1a   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_RedStar   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_SEY6210   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_SK1   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_T7   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPFQRG   266
YLR442C_UC5   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_UWOPS05_217_3   217   GQKTNRQVIHKMGVERSSRRLAKKPSMKKIKTEPSADDDVNNGNVPFQRG   266
YLR442C_VL3   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_Vin13   146   GSTEKAFKICEAAVEISKKDFVRKGGLQKGKLVVSQEMVPRYFSEAINGF   195
YLR442C_W303   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_X2180-1A   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_Y10   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_Y55   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_YJM269   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_YJM339   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_YJM789   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPFQRG   266
YLR442C_YPH499   217   GQKTNRQVMHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPSQRG   266
YLR442C_YPS128   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPFQRG   266
YLR442C_YPS163   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPFQRG   266
YLR442C_YS9   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNVPFQRG   266
YLR442C_ZTW1   217   GQKTNRQVIHKMGVERSSKRLAKKPSMKKIKIEPSADDDVNNGNIPFQRG   266
         

YLR442C_S288C   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_AWRI796   280   KDETISKKIIG-------------MSLLMRTFLYTLAQETEGTNRHTLAL   316
YLR442C_BC187   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_BY4741   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_BY4742   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_CEN.PK   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_CLIB215   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_CLIB324   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_D273-10B   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_DBVPG6044   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_EC1118   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_EC9-8   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_FL100   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_FY1679   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_FostersB   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_FostersO   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_JAY291   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_JK9-3d   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_K11   267   TSTTHGSISPQEESVSPNISSVSPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_Kyokai7   267   TSTTHGSISPQEESVSPNISSVSPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_L1528   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_LalvinQA23   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_RM11-1a   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_RedStar   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_SEY6210   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_SK1   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_T7   267   TSTSHGSISPQEESVSPNISSASPSELISPTDSSKILQKRSISKELIVSE   316
YLR442C_UC5   267   TSTTHGSISPQEESVSPNISSVSPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_UWOPS05_217_3   267   TSTSHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_VL3   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQXRSISKELIVSE   316
YLR442C_Vin13   196   KDETISKKIIG-------------MSLLMRTFLYTLAQETEGTNRHTLAL   232
YLR442C_W303   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_X2180-1A   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_Y10   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_Y55   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_YJM269   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_YJM339   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_YJM789   267   TSTSHGSISPQEESVSPNISSASPSELTSPTDSSKILQKRSISKELIVSE   316
YLR442C_YPH499   267   TSTTHGSISPQEESVSPNISSASPSALTSPTDSSKILQKRSISKELIVSE   316
YLR442C_YPS128   267   TSTSHGSISPQEESVSPNISSASPSELTSPTDSSKILQKRSISKELIVSE   316
YLR442C_YPS163   267   TSTSHGSISPQEESVSPNISSASPSELTSPTDSSKILQKRSISKELIVSE   316
YLR442C_YS9   267   TSTSHGSISPQEESVSSNISSASPSALTSPTDSSKILQERSISKELIVSE   316
YLR442C_ZTW1   267   TSTSHGSISPQEESVSPNISSASPSELTSPTDSSKILQKRSISKELIVSE   316
         

YLR442C_S288C   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_AWRI796   317   ETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVN   366
YLR442C_BC187   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_BY4741   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_BY4742   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_CEN.PK   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_CLIB215   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_CLIB324   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_D273-10B   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_DBVPG6044   317   EIPINSSEQESDYESNNEPSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_EC1118   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_EC9-8   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_FL100   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_FY1679   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_FostersB   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_FostersO   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_JAY291   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_JK9-3d   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_K11   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_Kyokai7   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_L1528   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_LalvinQA23   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_RM11-1a   317   EIPITSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_RedStar   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_SEY6210   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_SK1   317   EIPINSSEQESDYESNNEPSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_T7   317   EIPINSSEQESDYESNNEPSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_UC5   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_UWOPS05_217_3   317   EIPINSSEQESDYESNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_VL3   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_Vin13   233   ETVLIKMVKMLRDNPGYKASKEIKKVICGAWEPAITIEKLKQFSWISVVN   282
YLR442C_W303   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_X2180-1A   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_Y10   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_Y55   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_YJM269   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_YJM339   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_YJM789   317   EIPINSSEQESDYESNNEPSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_YPH499   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_YPS128   317   EIPINSSEQESDYESNNEPSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_YPS163   317   EIPINSSEQESDYESNNEPSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_YS9   317   EIPINSSEQESDYEPNNETSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
YLR442C_ZTW1   317   EIPINSSEQESDYESNNEPSVLSSKPGSKPEKTSTELVDGRENFVYANNP   366
         

YLR442C_S288C   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_AWRI796   367   DLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNMDCI-----   411
YLR442C_BC187   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_BY4741   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_BY4742   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_CEN.PK   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_CLIB215   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_CLIB324   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_D273-10B   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_DBVPG6044   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELGSKIRKIHIQET   416
YLR442C_EC1118   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGTELSSKIRKIHIQET   416
YLR442C_EC9-8   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_FL100   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_FY1679   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_FostersB   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_FostersO   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_JAY291   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_JK9-3d   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_K11   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_Kyokai7   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_L1528   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_LalvinQA23   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGXELSSKIRKIHIQET   416
YLR442C_RM11-1a   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_RedStar   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_SEY6210   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_SK1   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELGSKIRKIHIQET   416
YLR442C_T7   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELGSKIRKIHIQET   416
YLR442C_UC5   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_UWOPS05_217_3   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_VL3   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_Vin13   283   DLVGEKLVVVVLEEPSASIMVELKLPLEINYAFSMDEEFKNMDCI-----   327
YLR442C_W303   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_X2180-1A   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_Y10   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_Y55   367   AVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_YJM269   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_YJM339   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_YJM789   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_YPH499   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_YPS128   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELGSKIRKIHIQET   416
YLR442C_YPS163   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELGSKIRKIHIQET   416
YLR442C_YS9   367   EVSDDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELSSKIRKIHIQET   416
YLR442C_ZTW1   367   EVSGDGGLEEETDEVSSESSDEAIIPVNKRRGAHGSELGSKIRKIHIQET   416
         

YLR442C_S288C   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_AWRI796   
   --------------------------------------------------   
YLR442C_BC187   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_BY4741   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_BY4742   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_CEN.PK   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_CLIB215   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_CLIB324   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_D273-10B   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_DBVPG6044   417   QEFSQNYTTETDKKMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_EC1118   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_EC9-8   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_FL100   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_FY1679   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_FostersB   417   QEFSQNYTTETDNEMNGNGKPGIPRXNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_FostersO   417   QEFSQNYTTETDNEMNGNGKPGIPRCNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_JAY291   417   QEFSQNYTTETDNEMNGNGKPRIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_JK9-3d   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_K11   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_Kyokai7   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_L1528   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_LalvinQA23   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_RM11-1a   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_RedStar   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_SEY6210   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_SK1   417   QEFSQNYTTETDKKMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_T7   417   QEFSQNYTTETDKKMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_UC5   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_UWOPS05_217_3   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_VL3   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_Vin13   
   --------------------------------------------------   
YLR442C_W303   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_X2180-1A   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_Y10   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPSPEKGNAKMIDFA   466
YLR442C_Y55   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_YJM269   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_YJM339   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_YJM789   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_YPH499   417   QEFSKNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_YPS128   417   QEFSQNYTTETDKKMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_YPS163   417   QEFSQNYTTETDKKMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_YS9   417   QEFSQNYTTETDNEMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
YLR442C_ZTW1   417   QEFSQNYTTETDKKMNGNGKPGIPRGNTKIHSMNENPTPEKGNAKMIDFA   466
         

YLR442C_S288C   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_AWRI796   
   --------------------------------------------------   
YLR442C_BC187   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_BY4741   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_BY4742   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_CEN.PK   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_CLIB215   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_CLIB324   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_D273-10B   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_DBVPG6044   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKVTDEQSSLDVAGLEDKFRKA   516
YLR442C_EC1118   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_EC9-8   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_FL100   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_FY1679   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_FostersB   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_FostersO   467   TLSKLEKKXIR---------------------------------------   477
YLR442C_JAY291   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_JK9-3d   467   TLSKLKKKYQIILDRFAPDNQVTDSSQLNKLTDEQSSLDVAGLEDKFRKA   516
YLR442C_K11   467   TLSKLKKKYQI<