COX8/YLR395C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YLR395C_S288C   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_AWRI796   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_CBS7960   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_CLIB215   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_CLIB382   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKIPYA   50
YLR395C_EC1118   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKIPYA   50
YLR395C_EC9-8   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_FostersB   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_FostersO   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_JAY291   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_Kyokai7   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_LalvinQA23   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_M22   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_PW5   1   MLCQHMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_T7   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_T73   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_UC5   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_VL3   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_Vin13   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_Y10   1   -----------------------MKRSVHFKDGVYENIPFKVKGRKTPYA   27
YLR395C_YJM269   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_YJM789   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
YLR395C_ZTW1   1   MLCQQMIRTTAKRSSNIMTRPIIMKRSVHFKDGVYENIPFKVKGRKTPYA   50
         

YLR395C_S288C   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_AWRI796   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_CBS7960   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_CLIB215   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_CLIB382   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_EC1118   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_EC9-8   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_FostersB   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_FostersO   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_JAY291   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_Kyokai7   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_LalvinQA23   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_M22   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_PW5   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_T7   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_T73   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_UC5   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_VL3   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_Vin13   51   LSHFGFXAIGFAVPFVACYVQLKKSGAF   78
YLR395C_Y10   28   LSHFGFFAIGFAVPFVACYVQLKKSGAF   55
YLR395C_YJM269   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_YJM789   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
YLR395C_ZTW1   51   LSHFGFFAIGFAVPFVACYVQLKKSGAF   78
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YLR395C_S288C from SGD:

YLR395C_S288C [source=SGD]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_AWRI796 from AWRI:

YLR395C_AWRI796 [source=AWRI]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_CBS7960 from WashU:

YLR395C_CBS7960 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_CLIB215 from WashU:

YLR395C_CLIB215 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_CLIB382 from WashU:

YLR395C_CLIB382 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4146  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKIPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_EC1118 from Genoscope:

YLR395C_EC1118 [source=Genoscope]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4146  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKIPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_EC9-8 from ASinica:

YLR395C_EC9-8 [source=ASinica]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_FostersB from AWRI:

YLR395C_FostersB [source=AWRI]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_FostersO from AWRI:

YLR395C_FostersO [source=AWRI]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_JAY291 from Duke:

YLR395C_JAY291 [source=Duke]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_Kyokai7 from NRIB:

YLR395C_Kyokai7 [source=NRIB]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_LalvinQA23 from AWRI:

YLR395C_LalvinQA23 [source=AWRI]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_M22 from WashU:

YLR395C_M22 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_PW5 from WashU:

YLR395C_PW5 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4618  ..

       1  MLCQHMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_T7 from WashU:

YLR395C_T7 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_T73 from WashU:

YLR395C_T73 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_UC5 from WashU:

YLR395C_UC5 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_VL3 from AWRI:

YLR395C_VL3 [source=AWRI]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_Vin13 from AWRI:

YLR395C_Vin13 [source=AWRI]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 5689  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFXAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_Y10 from WashU:

YLR395C_Y10 [source=WashU]  Length: 56  Sun Sep 24 03:42:07 2017  Type: P  Check: 8135  ..

       1  MKRSVHFKDG VYENIPFKVK GRKTPYALSH FGFFAIGFAV PFVACYVQLK

      51  KSGAF*

Protein Sequence for YLR395C_YJM269 from WashU:

YLR395C_YJM269 [source=WashU]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_YJM789 from Stanford:

YLR395C_YJM789 [source=Stanford]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*

Protein Sequence for YLR395C_ZTW1 from Zhejiang:

YLR395C_ZTW1 [source=Zhejiang]  Length: 79  Sun Sep 24 03:42:07 2017  Type: P  Check: 4663  ..

       1  MLCQQMIRTT AKRSSNIMTR PIIMKRSVHF KDGVYENIPF KVKGRKTPYA

      51  LSHFGFFAIG FAVPFVACYV QLKKSGAF*