LIP2/YLR239C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YLR239C_S288C   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_AWRI1631   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_AWRI796   
   --------------------------------------------------   
YLR239C_BC187   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_BY4741   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_BY4742   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_CBS7960   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_CEN.PK   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_CLIB215   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_CLIB324   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_D273-10B   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_DBVPG6044   1   MSRCIHQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_EC1118   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_EC9-8   1   MSRCIRQSVCTNFNVCRRQCFSTYASVLKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_FL100   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_FY1679   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_FostersB   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_FostersO   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_JAY291   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_JK9-3d   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_K11   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_Kyokai7   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_L1528   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_LalvinQA23   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_M22   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_PW5   1   MSRCIHQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_RM11-1a   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_RedStar   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_SEY6210   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_SK1   1   MSRCIHQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_T7   1   MSRCIRQSVCTNFNVCRRQCFSTYASVLKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_T73   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_UWOPS05_217_3   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_VL3   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_Vin13   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_W303   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_X2180-1A   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_Y55   1   MSRCIHQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_YJM269   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_YJM339   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_YJM789   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_YPH499   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_YPS128   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_YPS163   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_YS9   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
YLR239C_ZTW1   1   MSRCIRQSVCTNFNVCRRQCFSTYASALKEMTHPIKPSAQTLRHLQFTQR   50
         

YLR239C_S288C   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_AWRI1631   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_AWRI796   
   --------------------------------------------------   
YLR239C_BC187   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_BY4741   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_BY4742   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_CBS7960   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_CEN.PK   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_CLIB215   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_CLIB324   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_D273-10B   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_DBVPG6044   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_EC1118   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_EC9-8   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_FL100   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_FY1679   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_FostersB   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_FostersO   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_JAY291   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_JK9-3d   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_K11   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_Kyokai7   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_L1528   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_LalvinQA23   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_M22   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_PW5   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_RM11-1a   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_RedStar   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_SEY6210   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_SK1   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_T7   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_T73   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_UWOPS05_217_3   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_VL3   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_Vin13   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_W303   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_X2180-1A   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_Y55   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_YJM269   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_YJM339   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_YJM789   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_YPH499   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_YPS128   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_YPS163   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_YS9   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
YLR239C_ZTW1   51   IPFQKGLEIQETLVRANLDIKDIQSKIERKLIQLDEEYKGTATINDNEKR   100
         

YLR239C_S288C   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_AWRI1631   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_AWRI796   1   -----MAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   45
YLR239C_BC187   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_BY4741   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_BY4742   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_CBS7960   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_CEN.PK   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_CLIB215   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_CLIB324   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_D273-10B   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_DBVPG6044   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_EC1118   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_EC9-8   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_FL100   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_FY1679   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_FostersB   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMXPDQIAAYESXIPETQK   150
YLR239C_FostersO   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_JAY291   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_JK9-3d   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_K11   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_Kyokai7   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_L1528   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_LalvinQA23   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_M22   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_PW5   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_RM11-1a   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_RedStar   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_SEY6210   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_SK1   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_T7   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_T73   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_UWOPS05_217_3   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_VL3   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_Vin13   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_W303   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_X2180-1A   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_Y55   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_YJM269   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_YJM339   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_YJM789   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_YPH499   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_YPS128   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_YPS163   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_YS9   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
YLR239C_ZTW1   101   ILDKVMAMKPNPIILTFEFEPTYTGGKRIKKTMTPDQIAAYESFIPETQK   150
         

YLR239C_S288C   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_AWRI1631   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_AWRI796   46   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   95
YLR239C_BC187   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_BY4741   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_BY4742   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_CBS7960   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_CEN.PK   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_CLIB215   151   DNPRPKFVQVERGGQVTFHGPGQIVIYTILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_CLIB324   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_D273-10B   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_DBVPG6044   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_EC1118   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_EC9-8   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_FL100   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_FY1679   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_FostersB   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_FostersO   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_JAY291   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_JK9-3d   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_K11   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_Kyokai7   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_L1528   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_LalvinQA23   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_M22   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_PW5   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_RM11-1a   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_RedStar   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_SEY6210   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_SK1   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_T7   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_T73   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_UWOPS05_217_3   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_VL3   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_Vin13   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_W303   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_X2180-1A   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_Y55   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_YJM269   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_YJM339   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_YJM789   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_YPH499   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_YPS128   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_YPS163   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_YS9   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
YLR239C_ZTW1   151   DNPRPKFVQVERGGQVTFHGPGQIVIYIILDLKTFQSFPAKCLVSCIEQA   200
         

YLR239C_S288C   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_AWRI1631   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_AWRI796   96   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   145
YLR239C_BC187   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_BY4741   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_BY4742   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_CBS7960   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASIGIHVRRSI   250
YLR239C_CEN.PK   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_CLIB215   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_CLIB324   201   TITTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_D273-10B   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_DBVPG6044   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_EC1118   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_EC9-8   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_FL100   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_FY1679   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_FostersB   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_FostersO   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_JAY291   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASIGIHVRRSI   250
YLR239C_JK9-3d   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_K11   201   TIRTLKNTKMCDGTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_Kyokai7   201   TIRTLKNTKMCDGTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_L1528   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_LalvinQA23   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_M22   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_PW5   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_RM11-1a   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_RedStar   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_SEY6210   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_SK1   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_T7   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_T73   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASIGIHVRRSI   250
YLR239C_UWOPS05_217_3   201   TIRTLKNTKMCDGTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_VL3   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKXASXGIHVRRSI   250
YLR239C_Vin13   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_W303   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_X2180-1A   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_Y55   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_YJM269   201   TIRTLKNTKMCDGTDKPLNLDAMTTKDTGVWVKNGKKKVASVGIHVRRSI   250
YLR239C_YJM339   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_YJM789   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_YPH499   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_YPS128   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_YPS163   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_YS9   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
YLR239C_ZTW1   201   TIRTLKNTKMCDDTDKPLNLDAMTTKDTGVWVENGKKKVASVGIHVRRSI   250
         

YLR239C_S288C   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_AWRI1631   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_AWRI796   146   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   195
YLR239C_BC187   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_BY4741   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_BY4742   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_CBS7960   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_CEN.PK   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_CLIB215   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_CLIB324   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_D273-10B   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_DBVPG6044   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_EC1118   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_EC9-8   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_FL100   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_FY1679   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_FostersB   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_FostersO   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_JAY291   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_JK9-3d   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_K11   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_Kyokai7   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_L1528   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_LalvinQA23   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_M22   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_PW5   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_RM11-1a   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_RedStar   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_SEY6210   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_SK1   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_T7   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_T73   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_UWOPS05_217_3   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_VL3   251   TSHGVAINVNTDLSYMNSFEMCGLEKYTDYFNYGTTTRCCCKCAKCSN--   298
YLR239C_Vin13   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_W303   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_X2180-1A   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_Y55   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_YJM269   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_YJM339   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_YJM789   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_YPH499   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_YPS128   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_YPS163   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_YS9   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
YLR239C_ZTW1   251   TSHGVAINVNTDLSYMNSFEMCGLKNTLTTSIMEQRPDAVVNVQSVAISF   300
         

YLR239C_S288C   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_AWRI1631   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_AWRI796   196   VKEMTKLLGIKTLERMQIDDVNILKKNP   223
YLR239C_BC187   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_BY4741   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_BY4742   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_CBS7960   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_CEN.PK   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_CLIB215   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_CLIB324   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_D273-10B   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_DBVPG6044   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_EC1118   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_EC9-8   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_FL100   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_FY1679   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_FostersB   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_FostersO   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_JAY291   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_JK9-3d   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_K11   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_Kyokai7   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_L1528   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_LalvinQA23   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_M22   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_PW5   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_RM11-1a   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_RedStar   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_SEY6210   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_SK1   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_T7   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_T73   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_UWOPS05_217_3   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_VL3   
   ----------------------------   
YLR239C_Vin13   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_W303   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_X2180-1A   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_Y55   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_YJM269   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_YJM339   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_YJM789   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_YPH499   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_YPS128   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_YPS163   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_YS9   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
YLR239C_ZTW1   301   VKEMTKLLGIKTLERMQIDDVNILKKNP   328
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YLR239C_S288C from SGD:

YLR239C_S288C [source=SGD]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_AWRI1631 from AWRI:

YLR239C_AWRI1631 [source=AWRI]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_AWRI796 from AWRI:

YLR239C_AWRI796 [source=AWRI]  Length: 224  Thu Oct 19 02:51:02 2017  Type: P  Check: 7431  ..

       1  MAMKPNPIIL TFEFEPTYTG GKRIKKTMTP DQIAAYESFI PETQKDNPRP

      51  KFVQVERGGQ VTFHGPGQIV IYIILDLKTF QSFPAKCLVS CIEQATIRTL

     101  KNTKMCDDTD KPLNLDAMTT KDTGVWVENG KKKVASVGIH VRRSITSHGV

     151  AINVNTDLSY MNSFEMCGLK NTLTTSIMEQ RPDAVVNVQS VAISFVKEMT

     201  KLLGIKTLER MQIDDVNILK KNP*

Protein Sequence for YLR239C_BC187 from Stanford:

YLR239C_BC187 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_BY4741 from Stanford:

YLR239C_BY4741 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_BY4742 from Stanford:

YLR239C_BY4742 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_CBS7960 from WashU:

YLR239C_CBS7960 [source=WashU]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5773  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SIGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_CEN.PK from Stanford:

YLR239C_CEN.PK [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_CLIB215 from WashU:

YLR239C_CLIB215 [source=WashU]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6032  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYTIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_CLIB324 from WashU:

YLR239C_CLIB324 [source=WashU]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6019  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TITTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_D273-10B from Stanford:

YLR239C_D273-10B [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_DBVPG6044 from Stanford:

YLR239C_DBVPG6044 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5895  ..

       1  MSRCIHQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_EC1118 from Genoscope:

YLR239C_EC1118 [source=Genoscope]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_EC9-8 from ASinica:

YLR239C_EC9-8 [source=ASinica]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6522  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASVLKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_FL100 from Stanford:

YLR239C_FL100 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_FY1679 from Stanford:

YLR239C_FY1679 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_FostersB from AWRI:

YLR239C_FostersB [source=AWRI]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6575  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMXPDQIAA YESXIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_FostersO from AWRI:

YLR239C_FostersO [source=AWRI]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_JAY291 from Duke:

YLR239C_JAY291 [source=Duke]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5773  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SIGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_JK9-3d from Stanford:

YLR239C_JK9-3d [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_K11 from Stanford:

YLR239C_K11 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6081  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDGTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_Kyokai7 from NRIB:

YLR239C_Kyokai7 [source=NRIB]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6081  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDGTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_L1528 from Stanford:

YLR239C_L1528 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_LalvinQA23 from AWRI:

YLR239C_LalvinQA23 [source=AWRI]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_M22 from WashU:

YLR239C_M22 [source=WashU]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_PW5 from WashU:

YLR239C_PW5 [source=WashU]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5895  ..

       1  MSRCIHQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_RM11-1a from Stanford:

YLR239C_RM11-1a [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_RedStar from Stanford:

YLR239C_RedStar [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_SEY6210 from Stanford:

YLR239C_SEY6210 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_SK1 from Stanford:

YLR239C_SK1 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5895  ..

       1  MSRCIHQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_T7 from WashU:

YLR239C_T7 [source=WashU]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6522  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASVLKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_T73 from WashU:

YLR239C_T73 [source=WashU]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5773  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SIGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_UWOPS05_217_3 from Stanford:

YLR239C_UWOPS05_217_3 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6081  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDGTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_VL3 from AWRI:

YLR239C_VL3 [source=AWRI]  Length: 299  Thu Oct 19 02:51:02 2017  Type: P  Check: 9288  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKXA SXGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLEKYTDY FNYGTTTRCC CKCAKCSN*


Protein Sequence for YLR239C_Vin13 from AWRI:

YLR239C_Vin13 [source=AWRI]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_W303 from Stanford:

YLR239C_W303 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_X2180-1A from Stanford:

YLR239C_X2180-1A [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_Y55 from Stanford:

YLR239C_Y55 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5895  ..

       1  MSRCIHQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_YJM269 from WashU:

YLR239C_YJM269 [source=WashU]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 6111  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDGTDKPLNL DAMTTKDTGV WVKNGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_YJM339 from Stanford:

YLR239C_YJM339 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_YJM789 from Stanford:

YLR239C_YJM789 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_YPH499 from Stanford:

YLR239C_YPH499 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_YPS128 from Stanford:

YLR239C_YPS128 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_YPS163 from Stanford:

YLR239C_YPS163 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_YS9 from Stanford:

YLR239C_YS9 [source=Stanford]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*

Protein Sequence for YLR239C_ZTW1 from Zhejiang:

YLR239C_ZTW1 [source=Zhejiang]  Length: 329  Thu Oct 19 02:51:02 2017  Type: P  Check: 5955  ..

       1  MSRCIRQSVC TNFNVCRRQC FSTYASALKE MTHPIKPSAQ TLRHLQFTQR

      51  IPFQKGLEIQ ETLVRANLDI KDIQSKIERK LIQLDEEYKG TATINDNEKR

     101  ILDKVMAMKP NPIILTFEFE PTYTGGKRIK KTMTPDQIAA YESFIPETQK

     151  DNPRPKFVQV ERGGQVTFHG PGQIVIYIIL DLKTFQSFPA KCLVSCIEQA

     201  TIRTLKNTKM CDDTDKPLNL DAMTTKDTGV WVENGKKKVA SVGIHVRRSI

     251  TSHGVAINVN TDLSYMNSFE MCGLKNTLTT SIMEQRPDAV VNVQSVAISF

     301  VKEMTKLLGI KTLERMQIDD VNILKKNP*