YLR159C-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YLR159C-A_S288C   1   MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW   43
YLR159C-A_CLIB324   1   MYSCAKKKTTAAPEFRVWSPTTLLGQALTSLTTVDRTGNGAFW   43
YLR159C-A_T73   1   MYSCAKKKRLQHLSFAYGHPLHYSVRLLPA-------------   30
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YLR159C-A_S288C from SGD:

YLR159C-A_S288C [source=SGD]  Length: 44  Tue Sep 19 16:39:50 2017  Type: P  Check: 5164  ..

       1  MYSCAKKKTT AAPEFRVWSP TTLLGQALTS LTTVDRTGNG AFW*


Protein Sequence for YLR159C-A_CLIB324 from WashU:

YLR159C-A_CLIB324 [source=WashU]  Length: 44  Tue Sep 19 16:39:50 2017  Type: P  Check: 5164  ..

       1  MYSCAKKKTT AAPEFRVWSP TTLLGQALTS LTTVDRTGNG AFW*


Protein Sequence for YLR159C-A_T73 from WashU:

YLR159C-A_T73 [source=WashU]  Length: 31  Tue Sep 19 16:39:50 2017  Type: P  Check: 7177  ..

       1  MYSCAKKKRL QHLSFAYGHP LHYSVRLLPA *