ASP3-1/YLR155C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YLR155C_S288C   1   MRSLNTLLLSLFVAMSSGAPLLKIREEKNSSLPSIKIFGTGGTIASKGST   50
YLR155C_CBS7960   1   MRSLNTLLLSLFVALSSGAPLLKIREEKNSSLPSIKIFGTGGTIASKGST   50
YLR155C_CLIB324   1   MRSLNTLLLSLFVAMSSGAPLIKIREEKNSSLPSIKIFGPGGIIASKGST   50
YLR155C_JAY291   1   MRSLNTLLLSLFVALSSGAPLLKIREEKNSSLPSIKIFGTGGTIASKGST   50
YLR155C_T73   1   MRSLNTLLLSLFVALSSGAPLLKIREEKNSSLPSIKIFGTGGTIASKGST   50
         

YLR155C_S288C   51   SATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLNYTHLIPL   100
YLR155C_CBS7960   51   SATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSNVGSESLNYTHLIPL   100
YLR155C_CLIB324   51   SATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSNVGSNSLNYTHLIPL   100
YLR155C_JAY291   51   SATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSNVGSESLNYTHLIPL   100
YLR155C_T73   51   SATTAGYSVGLTVNDLIEAVPSLAEKANLDYLQVSNVGSESLNYTHLIPL   100
         

YLR155C_S288C   101   YHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP   150
YLR155C_CBS7960   101   YHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP   150
YLR155C_CLIB324   101   YHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP   150
YLR155C_JAY291   101   YHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP   150
YLR155C_T73   101   YHGISEALASDDYAGAVVTHGTDTMEETAFFLDLTINSEKPVCIAGAMRP   150
         

YLR155C_S288C   151   ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANS   200
YLR155C_CBS7960   151   ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANS   200
YLR155C_CLIB324   151   ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANS   200
YLR155C_JAY291   151   ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANS   200
YLR155C_T73   151   ATATSADGPMNLYQAVSIAASEKSLGRGTMITLNDRIASGFWTTKMNANS   200
         

YLR155C_S288C   201   LDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVI   250
YLR155C_CBS7960   201   LDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVI   250
YLR155C_CLIB324   201   LDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVI   250
YLR155C_JAY291   201   LDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVI   250
YLR155C_T73   201   LDTFRADEQGYLGYFSNDDVEFYYPPVKPNGWQFFDISNLTDPSEIPEVI   250
         

YLR155C_S288C   251   ILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEY   300
YLR155C_CBS7960   251   ILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEY   300
YLR155C_CLIB324   251   ILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEY   300
YLR155C_JAY291   251   ILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEY   300
YLR155C_T73   251   ILYSYQGLNPELIVKAVKDLGAKGIVLAGSGAGSWTATGSIVNEQLYEEY   300
         

YLR155C_S288C   301   GIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMD   350
YLR155C_CBS7960   301   GIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMD   350
YLR155C_CLIB324   301   GIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMD   350
YLR155C_JAY291   301   GIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMD   350
YLR155C_T73   301   GIPIVHSRRTADGTVPPDDAPEYAIGSGYLNPQKSRILLQLCLYSGYGMD   350
         

YLR155C_S288C   351   QIRSVFSGVYGG   362
YLR155C_CBS7960   351   QIRSVFSGVYGG   362
YLR155C_CLIB324   351   QIRSVFSGVYGG   362
YLR155C_JAY291   351   QIRSVFSGVYGG   362
YLR155C_T73   351   QIRSVFSGVYGG   362
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YLR155C_S288C from SGD:

YLR155C_S288C [source=SGD]  Length: 363  Mon Oct 23 05:00:43 2017  Type: P  Check: 3400  ..

       1  MRSLNTLLLS LFVAMSSGAP LLKIREEKNS SLPSIKIFGT GGTIASKGST

      51  SATTAGYSVG LTVNDLIEAV PSLAEKANLD YLQVSNVGSN SLNYTHLIPL

     101  YHGISEALAS DDYAGAVVTH GTDTMEETAF FLDLTINSEK PVCIAGAMRP

     151  ATATSADGPM NLYQAVSIAA SEKSLGRGTM ITLNDRIASG FWTTKMNANS

     201  LDTFRADEQG YLGYFSNDDV EFYYPPVKPN GWQFFDISNL TDPSEIPEVI

     251  ILYSYQGLNP ELIVKAVKDL GAKGIVLAGS GAGSWTATGS IVNEQLYEEY

     301  GIPIVHSRRT ADGTVPPDDA PEYAIGSGYL NPQKSRILLQ LCLYSGYGMD

     351  QIRSVFSGVY GG*

Protein Sequence for YLR155C_CBS7960 from WashU:

YLR155C_CBS7960 [source=WashU]  Length: 363  Mon Oct 23 05:00:43 2017  Type: P  Check: 3088  ..

       1  MRSLNTLLLS LFVALSSGAP LLKIREEKNS SLPSIKIFGT GGTIASKGST

      51  SATTAGYSVG LTVNDLIEAV PSLAEKANLD YLQVSNVGSE SLNYTHLIPL

     101  YHGISEALAS DDYAGAVVTH GTDTMEETAF FLDLTINSEK PVCIAGAMRP

     151  ATATSADGPM NLYQAVSIAA SEKSLGRGTM ITLNDRIASG FWTTKMNANS

     201  LDTFRADEQG YLGYFSNDDV EFYYPPVKPN GWQFFDISNL TDPSEIPEVI

     251  ILYSYQGLNP ELIVKAVKDL GAKGIVLAGS GAGSWTATGS IVNEQLYEEY

     301  GIPIVHSRRT ADGTVPPDDA PEYAIGSGYL NPQKSRILLQ LCLYSGYGMD

     351  QIRSVFSGVY GG*

Protein Sequence for YLR155C_CLIB324 from WashU:

YLR155C_CLIB324 [source=WashU]  Length: 363  Mon Oct 23 05:00:43 2017  Type: P  Check: 2701  ..

       1  MRSLNTLLLS LFVAMSSGAP LIKIREEKNS SLPSIKIFGP GGIIASKGST

      51  SATTAGYSVG LTVNDLIEAV PSLAEKANLD YLQVSNVGSN SLNYTHLIPL

     101  YHGISEALAS DDYAGAVVTH GTDTMEETAF FLDLTINSEK PVCIAGAMRP

     151  ATATSADGPM NLYQAVSIAA SEKSLGRGTM ITLNDRIASG FWTTKMNANS

     201  LDTFRADEQG YLGYFSNDDV EFYYPPVKPN GWQFFDISNL TDPSEIPEVI

     251  ILYSYQGLNP ELIVKAVKDL GAKGIVLAGS GAGSWTATGS IVNEQLYEEY

     301  GIPIVHSRRT ADGTVPPDDA PEYAIGSGYL NPQKSRILLQ LCLYSGYGMD

     351  QIRSVFSGVY GG*

Protein Sequence for YLR155C_JAY291 from Duke:

YLR155C_JAY291 [source=Duke]  Length: 363  Mon Oct 23 05:00:43 2017  Type: P  Check: 3088  ..

       1  MRSLNTLLLS LFVALSSGAP LLKIREEKNS SLPSIKIFGT GGTIASKGST

      51  SATTAGYSVG LTVNDLIEAV PSLAEKANLD YLQVSNVGSE SLNYTHLIPL

     101  YHGISEALAS DDYAGAVVTH GTDTMEETAF FLDLTINSEK PVCIAGAMRP

     151  ATATSADGPM NLYQAVSIAA SEKSLGRGTM ITLNDRIASG FWTTKMNANS

     201  LDTFRADEQG YLGYFSNDDV EFYYPPVKPN GWQFFDISNL TDPSEIPEVI

     251  ILYSYQGLNP ELIVKAVKDL GAKGIVLAGS GAGSWTATGS IVNEQLYEEY

     301  GIPIVHSRRT ADGTVPPDDA PEYAIGSGYL NPQKSRILLQ LCLYSGYGMD

     351  QIRSVFSGVY GG*

Protein Sequence for YLR155C_T73 from WashU:

YLR155C_T73 [source=WashU]  Length: 363  Mon Oct 23 05:00:43 2017  Type: P  Check: 3088  ..

       1  MRSLNTLLLS LFVALSSGAP LLKIREEKNS SLPSIKIFGT GGTIASKGST

      51  SATTAGYSVG LTVNDLIEAV PSLAEKANLD YLQVSNVGSE SLNYTHLIPL

     101  YHGISEALAS DDYAGAVVTH GTDTMEETAF FLDLTINSEK PVCIAGAMRP

     151  ATATSADGPM NLYQAVSIAA SEKSLGRGTM ITLNDRIASG FWTTKMNANS

     201  LDTFRADEQG YLGYFSNDDV EFYYPPVKPN GWQFFDISNL TDPSEIPEVI

     251  ILYSYQGLNP ELIVKAVKDL GAKGIVLAGS GAGSWTATGS IVNEQLYEEY

     301  GIPIVHSRRT ADGTVPPDDA PEYAIGSGYL NPQKSRILLQ LCLYSGYGMD

     351  QIRSVFSGVY GG*