SHM2/YLR058C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YLR058C_S288C   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_AWRI796   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_BC187   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_BY4741   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_BY4742   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_CBS7960   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_CEN.PK   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_CLIB324   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_D273-10B   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_DBVPG6044   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_EC1118   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_EC9-8   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_FL100   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_FY1679   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_FostersB   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_FostersO   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_JAY291   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_JK9-3d   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_K11   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_Kyokai7   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_L1528   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_LalvinQA23   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTSX   50
YLR058C_M22   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_PW5   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_RM11-1a   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_RedStar   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_SEY6210   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_SK1   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_T7   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_T73   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_UC5   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_UWOPS05_217_3   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_VL3   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_Vin13   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_W303   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_X2180-1A   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_Y55   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_YJM339   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_YJM789   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_YPH499   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_YPS128   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_YPS163   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_YS9   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
YLR058C_ZTW1   1   MPYTLSDAHHKLITSHLVDTDPEVDSIIKDEIERQKHSIDLIASENFTST   50
         

YLR058C_S288C   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_AWRI796   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_BC187   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_BY4741   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_BY4742   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_CBS7960   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_CEN.PK   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_CLIB324   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_D273-10B   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_DBVPG6044   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_EC1118   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_EC9-8   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_FL100   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_FY1679   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_FostersB   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_FostersO   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_JAY291   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_JK9-3d   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_K11   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_Kyokai7   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_L1528   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_LalvinQA23   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_M22   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_PW5   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_RM11-1a   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_RedStar   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_SEY6210   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_SK1   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_T7   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_T73   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_UC5   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_UWOPS05_217_3   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_VL3   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_Vin13   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_W303   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_X2180-1A   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_Y55   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_YJM339   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_YJM789   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_YPH499   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_YPS128   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_YPS163   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_YS9   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
YLR058C_ZTW1   51   SVFDALGTPLSNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHVTPD   100
         

YLR058C_S288C   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_AWRI796   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_BC187   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_BY4741   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_BY4742   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_CBS7960   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_CEN.PK   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_CLIB324   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_D273-10B   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_DBVPG6044   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_EC1118   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_EC9-8   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_FL100   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_FY1679   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_FostersB   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_FostersO   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_JAY291   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_JK9-3d   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_K11   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_Kyokai7   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_L1528   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_LalvinQA23   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_M22   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_PW5   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_RM11-1a   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_RedStar   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_SEY6210   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_SK1   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_T7   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_T73   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_UC5   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_UWOPS05_217_3   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_VL3   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_Vin13   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_W303   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_X2180-1A   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_Y55   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_YJM339   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_YJM789   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_YPH499   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_YPS128   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_YPS163   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_YS9   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
YLR058C_ZTW1   101   KWGVNVQTLSGSPANLQVYQAIMKPHERLMGLYLPDGGHLSHGYATENRK   150
         

YLR058C_S288C   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_AWRI796   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_BC187   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_BY4741   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_BY4742   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_CBS7960   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_CEN.PK   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_CLIB324   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_D273-10B   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_DBVPG6044   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_EC1118   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_EC9-8   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_FL100   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_FY1679   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_FostersB   151   ISAVSTYXESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_FostersO   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_JAY291   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_JK9-3d   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_K11   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_Kyokai7   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_L1528   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_LalvinQA23   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_M22   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_PW5   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_RM11-1a   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_RedStar   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_SEY6210   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_SK1   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_T7   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_T73   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_UC5   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_UWOPS05_217_3   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_VL3   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_Vin13   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_W303   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_X2180-1A   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_Y55   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_YJM339   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_YJM789   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_YPH499   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_YPS128   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_YPS163   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_YS9   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
YLR058C_ZTW1   151   ISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTSAYCRLI   200
         

YLR058C_S288C   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_AWRI796   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_BC187   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_BY4741   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_BY4742   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_CBS7960   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_CEN.PK   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_CLIB324   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_D273-10B   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_DBVPG6044   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_EC1118   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_EC9-8   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_FL100   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_FY1679   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_FostersB   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSX   250
YLR058C_FostersO   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_JAY291   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_JK9-3d   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_K11   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_Kyokai7   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_L1528   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_LalvinQA23   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSX   250
YLR058C_M22   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_PW5   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_RM11-1a   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_RedStar   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_SEY6210   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_SK1   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_T7   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_T73   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_UC5   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_UWOPS05_217_3   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_VL3   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_Vin13   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_W303   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_X2180-1A   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_Y55   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_YJM339   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_YJM789   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_YPH499   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_YPS128   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_YPS163   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_YS9   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
YLR058C_ZTW1   201   DYKRMREIADKCGAYLMVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSL   250
         

YLR058C_S288C   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_AWRI796   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_BC187   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_BY4741   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_BY4742   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_CBS7960   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_CEN.PK   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_CLIB324   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_D273-10B   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_DBVPG6044   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_EC1118   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_EC9-8   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPLTSLFSQVTKVVHTTIPL   300
YLR058C_FL100   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_FY1679   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_FostersB   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_FostersO   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_JAY291   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_JK9-3d   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_K11   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_Kyokai7   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_L1528   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_LalvinQA23   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_M22   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_PW5   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_RM11-1a   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_RedStar   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_SEY6210   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_SK1   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_T7   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_T73   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_UC5   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_UWOPS05_217_3   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_VL3   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_Vin13   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_W303   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_X2180-1A   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_Y55   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_YJM339   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_YJM789   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_YPH499   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_YPS128   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_YPS163   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_YS9   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
YLR058C_ZTW1   251   RGPRGAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTI   300
         

YLR058C_S288C   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_AWRI796   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_BC187   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_BY4741   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_BY4742   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_CBS7960   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSDGTDSHMV   350
YLR058C_CEN.PK   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_CLIB324   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_D273-10B   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_DBVPG6044   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_EC1118   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_EC9-8   301   LLWPLL--------------------------------------------   306
YLR058C_FL100   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_FY1679   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_FostersB   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_FostersO   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_JAY291   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSDGTDSHMV   350
YLR058C_JK9-3d   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_K11   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_Kyokai7   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_L1528   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_LalvinQA23   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSXGTDSHMV   350
YLR058C_M22   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_PW5   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_RM11-1a   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_RedStar   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_SEY6210   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_SK1   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_T7   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_T73   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSDGTDSHMV   350
YLR058C_UC5   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_UWOPS05_217_3   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_VL3   301   AALATALKQAATPEFKEYQTQVLKEC------------------------   326
YLR058C_Vin13   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSXGTDSHMV   350
YLR058C_W303   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_X2180-1A   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_Y55   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_YJM339   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSDGTDSHMV   350
YLR058C_YJM789   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSDGTDSHMV   350
YLR058C_YPH499   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_YPS128   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_YPS163   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_YS9   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
YLR058C_ZTW1   301   AALATALKQAATPEFKEYQTQVLKNAKALESEFKNLGYRLVSNGTDSHMV   350
         

YLR058C_S288C   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_AWRI796   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_BC187   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_BY4741   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_BY4742   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_CBS7960   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_CEN.PK   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_CLIB324   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_D273-10B   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_DBVPG6044   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_EC1118   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_EC9-8   
   --------------------------------------------------   
YLR058C_FL100   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_FY1679   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_FostersB   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_FostersO   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_JAY291   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_JK9-3d   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_K11   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_Kyokai7   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_L1528   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_LalvinQA23   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_M22   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_PW5   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_RM11-1a   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_RedStar   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_SEY6210   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_SK1   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_T7   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_T73   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_UC5   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_UWOPS05_217_3   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_VL3   
   --------------------------------------------------   
YLR058C_Vin13   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_W303   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_X2180-1A   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_Y55   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_YJM339   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_YJM789   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_YPH499   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_YPS128   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_YPS163   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_YS9   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
YLR058C_ZTW1   351   LVSLREKGVDGARVEYICEKINIALNKNSIPGDKSALVPGGVRIGAPAMT   400
         

YLR058C_S288C   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_AWRI796   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_BC187   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_BY4741   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_BY4742   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_CBS7960   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_CEN.PK   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_CLIB324   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_D273-10B   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_DBVPG6044   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_EC1118   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_EC9-8   
   --------------------------------------------------   
YLR058C_FL100   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_FY1679   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_FostersB   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRXKDFKAKVDEGSDV   450
YLR058C_FostersO   401   TRGMGEEDFHRIVQYINKAVXFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_JAY291   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_JK9-3d   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_K11   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_Kyokai7   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_L1528   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_LalvinQA23   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_M22   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_PW5   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_RM11-1a   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_RedStar   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_SEY6210   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_SK1   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_T7   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_T73   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_UC5   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_UWOPS05_217_3   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_VL3   
   --------------------------------------------------   
YLR058C_Vin13   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_W303   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_X2180-1A   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_Y55   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_YJM339   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_YJM789   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_YPH499   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_YPS128   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_YPS163   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_YS9   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
YLR058C_ZTW1   401   TRGMGEEDFHRIVQYINKAVEFAQQVQQSLPKDACRLKDFKAKVDEGSDV   450
         

YLR058C_S288C   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_AWRI796   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_BC187   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_BY4741   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_BY4742   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_CBS7960   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_CEN.PK   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_CLIB324   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_D273-10B   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_DBVPG6044   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_EC1118   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_EC9-8   
   --------------------------------   
YLR058C_FL100   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_FY1679   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_FostersB   451   LNTXEKGNLRLGWRIPIGCVKKSPQRHLIPKK   482
YLR058C_FostersO   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_JAY291   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_JK9-3d   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_K11   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_Kyokai7   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_L1528   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_LalvinQA23   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_M22   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_PW5   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_RM11-1a   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_RedStar   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_SEY6210   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_SK1   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_T7   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_T73   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_UC5   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_UWOPS05_217_3   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_VL3   
   --------------------------------   
YLR058C_Vin13   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_W303   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_X2180-1A   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_Y55   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_YJM339   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_YJM789   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_YPH499   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_YPS128   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_YPS163   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_YS9   451   LNTWKKEIYDWAGEYPLAV-------------   469
YLR058C_ZTW1   451   LNTWKKEIYDWAGEYPLAV-------------   469
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YLR058C_S288C from SGD:

YLR058C_S288C [source=SGD]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_AWRI796 from AWRI:

YLR058C_AWRI796 [source=AWRI]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_BC187 from Stanford:

YLR058C_BC187 [source=Stanford]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_BY4741 from Stanford:

YLR058C_BY4741 [source=Stanford]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_BY4742 from Stanford:

YLR058C_BY4742 [source=Stanford]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_CBS7960 from WashU:

YLR058C_CBS7960 [source=WashU]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2858  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSDGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_CEN.PK from Stanford:

YLR058C_CEN.PK [source=Stanford]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_CLIB324 from WashU:

YLR058C_CLIB324 [source=WashU]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_D273-10B from Stanford:

YLR058C_D273-10B [source=Stanford]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_DBVPG6044 from Stanford:

YLR058C_DBVPG6044 [source=Stanford]  Length: 470  Mon Sep 25 00:03:14 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_EC1118 from Genoscope:

YLR058C_EC1118 [source=Genoscope]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_EC9-8 from ASinica:

YLR058C_EC9-8 [source=ASinica]  Length: 307  Mon Sep 25 00:03:15 2017  Type: P  Check: 297  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPLTSLFSQV TKVVHTTIPL

     301  LLWPLL*

Protein Sequence for YLR058C_FL100 from Stanford:

YLR058C_FL100 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_FY1679 from Stanford:

YLR058C_FY1679 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_FostersB from AWRI:

YLR058C_FostersB [source=AWRI]  Length: 483  Mon Sep 25 00:03:15 2017  Type: P  Check: 4686  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYXES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSX

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRXKDF KAKVDEGSDV

     451  LNTXEKGNLR LGWRIPIGCV KKSPQRHLIP KK*

Protein Sequence for YLR058C_FostersO from AWRI:

YLR058C_FostersO [source=AWRI]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 3286  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV XFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_JAY291 from Duke:

YLR058C_JAY291 [source=Duke]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2858  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSDGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_JK9-3d from Stanford:

YLR058C_JK9-3d [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_K11 from Stanford:

YLR058C_K11 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_Kyokai7 from NRIB:

YLR058C_Kyokai7 [source=NRIB]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_L1528 from Stanford:

YLR058C_L1528 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_LalvinQA23 from AWRI:

YLR058C_LalvinQA23 [source=AWRI]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 3342  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTSX

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSX

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSXGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_M22 from WashU:

YLR058C_M22 [source=WashU]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_PW5 from WashU:

YLR058C_PW5 [source=WashU]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_RM11-1a from Stanford:

YLR058C_RM11-1a [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_RedStar from Stanford:

YLR058C_RedStar [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_SEY6210 from Stanford:

YLR058C_SEY6210 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_SK1 from Stanford:

YLR058C_SK1 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_T7 from WashU:

YLR058C_T7 [source=WashU]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_T73 from WashU:

YLR058C_T73 [source=WashU]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2858  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSDGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_UC5 from WashU:

YLR058C_UC5 [source=WashU]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_UWOPS05_217_3 from Stanford:

YLR058C_UWOPS05_217_3 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_VL3 from AWRI:

YLR058C_VL3 [source=AWRI]  Length: 327  Mon Sep 25 00:03:15 2017  Type: P  Check: 6335  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKEC*

Protein Sequence for YLR058C_Vin13 from AWRI:

YLR058C_Vin13 [source=AWRI]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2878  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSXGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_W303 from Stanford:

YLR058C_W303 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_X2180-1A from Stanford:

YLR058C_X2180-1A [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_Y55 from Stanford:

YLR058C_Y55 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_YJM339 from Stanford:

YLR058C_YJM339 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2858  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSDGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_YJM789 from Stanford:

YLR058C_YJM789 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2858  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSDGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_YPH499 from Stanford:

YLR058C_YPH499 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_YPS128 from Stanford:

YLR058C_YPS128 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_YPS163 from Stanford:

YLR058C_YPS163 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_YS9 from Stanford:

YLR058C_YS9 [source=Stanford]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*

Protein Sequence for YLR058C_ZTW1 from Zhejiang:

YLR058C_ZTW1 [source=Zhejiang]  Length: 470  Mon Sep 25 00:03:15 2017  Type: P  Check: 2868  ..

       1  MPYTLSDAHH KLITSHLVDT DPEVDSIIKD EIERQKHSID LIASENFTST

      51  SVFDALGTPL SNKYSEGYPG ARYYGGNEHI DRMEILCQQR ALKAFHVTPD

     101  KWGVNVQTLS GSPANLQVYQ AIMKPHERLM GLYLPDGGHL SHGYATENRK

     151  ISAVSTYFES FPYRVNPETG IIDYDTLEKN AILYRPKVLV AGTSAYCRLI

     201  DYKRMREIAD KCGAYLMVDM AHISGLIAAG VIPSPFEYAD IVTTTTHKSL

     251  RGPRGAMIFF RRGVRSINPK TGKEVLYDLE NPINFSVFPG HQGGPHNHTI

     301  AALATALKQA ATPEFKEYQT QVLKNAKALE SEFKNLGYRL VSNGTDSHMV

     351  LVSLREKGVD GARVEYICEK INIALNKNSI PGDKSALVPG GVRIGAPAMT

     401  TRGMGEEDFH RIVQYINKAV EFAQQVQQSL PKDACRLKDF KAKVDEGSDV

     451  LNTWKKEIYD WAGEYPLAV*