YLR012C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YLR012C_S288C   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_AWRI1631   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_AWRI796   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_BY4741   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_BY4742   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_CBS7960   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_CEN.PK   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_CLIB215   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_CLIB324   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_EC1118   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_FL100   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_FY1679   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_FostersB   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_FostersO   
   --------------------------------------------------   
YLR012C_JAY291   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_JK9-3d   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_L1528   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_LalvinQA23   1   -----------------------MKTVYYKEITYQQYLQLQPXQQEKYLA   27
YLR012C_M22   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_PW5   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_RM11-1a   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_SEY6210   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_T73   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_VL3   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_Vin13   1   -----------------------MKTVYYKEITYQQYLQLQPXQQEKYLA   27
YLR012C_W303   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_X2180-1A   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_Y10   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_YJM269   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_YJM789   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
YLR012C_YPH499   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_YS9   1   MKTAASRQKIFIEIKRKSLEHIQMKTVYYKEITYQQYLQLQPEQQEKYLA   50
YLR012C_ZTW1   1   -----------------------MKTVYYKEITYQQYLQLQPEQQEKYLA   27
         

YLR012C_S288C   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_AWRI1631   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_AWRI796   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_BY4741   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_BY4742   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_CBS7960   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_CEN.PK   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_CLIB215   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_CLIB324   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_EC1118   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_FL100   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_FY1679   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_FostersB   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_FostersO   1   --------------------------------------------MNAYIP   6
YLR012C_JAY291   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_JK9-3d   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_L1528   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_LalvinQA23   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_M22   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_PW5   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_RM11-1a   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_SEY6210   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_T73   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_VL3   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_Vin13   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_W303   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_X2180-1A   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_Y10   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_YJM269   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_YJM789   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
YLR012C_YPH499   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_YS9   51   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   100
YLR012C_ZTW1   28   LCQKDFEQETERIAFDRQGGVPGIARKFAQEEVAWFDRVTTWSYMNAYIP   77
         

YLR012C_S288C   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_AWRI1631   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_AWRI796   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_BY4741   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_BY4742   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_CBS7960   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_CEN.PK   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_CLIB215   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_CLIB324   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_EC1118   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_FL100   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_FY1679   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_FostersB   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_FostersO   7   SYRRRRNLLKIDMLKMXNAEEY   28
YLR012C_JAY291   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_JK9-3d   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_L1528   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_LalvinQA23   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_M22   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_PW5   78   SYRRRRNFLKIDMLKMSNAEEY   99
YLR012C_RM11-1a   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_SEY6210   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_T73   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_VL3   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_Vin13   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_W303   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_X2180-1A   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_Y10   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_YJM269   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_YJM789   78   SYRRRRNLLKIDMLKMSNAEEY   99
YLR012C_YPH499   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_YS9   101   SYRRRRNLLKIDMLKMSNAEEY   122
YLR012C_ZTW1   78   SYRRRRNLLKIDMLKMSNAEEY   99
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YLR012C_S288C from SGD:

YLR012C_S288C [source=SGD]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_AWRI1631 from AWRI:

YLR012C_AWRI1631 [source=AWRI]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_AWRI796 from AWRI:

YLR012C_AWRI796 [source=AWRI]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_BY4741 from Stanford:

YLR012C_BY4741 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_BY4742 from Stanford:

YLR012C_BY4742 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_CBS7960 from WashU:

YLR012C_CBS7960 [source=WashU]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_CEN.PK from Stanford:

YLR012C_CEN.PK [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_CLIB215 from WashU:

YLR012C_CLIB215 [source=WashU]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_CLIB324 from WashU:

YLR012C_CLIB324 [source=WashU]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_EC1118 from Genoscope:

YLR012C_EC1118 [source=Genoscope]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_FL100 from Stanford:

YLR012C_FL100 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_FY1679 from Stanford:

YLR012C_FY1679 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_FostersB from AWRI:

YLR012C_FostersB [source=AWRI]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_FostersO from AWRI:

YLR012C_FostersO [source=AWRI]  Length: 29  Mon Oct 23 04:57:31 2017  Type: P  Check: 2389  ..

       1  MNAYIPSYRR RRNLLKIDML KMXNAEEY*

Protein Sequence for YLR012C_JAY291 from Duke:

YLR012C_JAY291 [source=Duke]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_JK9-3d from Stanford:

YLR012C_JK9-3d [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_L1528 from Stanford:

YLR012C_L1528 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_LalvinQA23 from AWRI:

YLR012C_LalvinQA23 [source=AWRI]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 6137  ..

       1  MKTVYYKEIT YQQYLQLQPX QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_M22 from WashU:

YLR012C_M22 [source=WashU]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_PW5 from WashU:

YLR012C_PW5 [source=WashU]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5589  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNFLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_RM11-1a from Stanford:

YLR012C_RM11-1a [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_SEY6210 from Stanford:

YLR012C_SEY6210 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_T73 from WashU:

YLR012C_T73 [source=WashU]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_VL3 from AWRI:

YLR012C_VL3 [source=AWRI]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_Vin13 from AWRI:

YLR012C_Vin13 [source=AWRI]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 6137  ..

       1  MKTVYYKEIT YQQYLQLQPX QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_W303 from Stanford:

YLR012C_W303 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_X2180-1A from Stanford:

YLR012C_X2180-1A [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_Y10 from WashU:

YLR012C_Y10 [source=WashU]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_YJM269 from WashU:

YLR012C_YJM269 [source=WashU]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_YJM789 from Stanford:

YLR012C_YJM789 [source=Stanford]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*


Protein Sequence for YLR012C_YPH499 from Stanford:

YLR012C_YPH499 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_YS9 from Stanford:

YLR012C_YS9 [source=Stanford]  Length: 123  Mon Oct 23 04:57:31 2017  Type: P  Check: 8516  ..

       1  MKTAASRQKI FIEIKRKSLE HIQMKTVYYK EITYQQYLQL QPEQQEKYLA

      51  LCQKDFEQET ERIAFDRQGG VPGIARKFAQ EEVAWFDRVT TWSYMNAYIP

     101  SYRRRRNLLK IDMLKMSNAE EY*

Protein Sequence for YLR012C_ZTW1 from Zhejiang:

YLR012C_ZTW1 [source=Zhejiang]  Length: 100  Mon Oct 23 04:57:31 2017  Type: P  Check: 5757  ..

       1  MKTVYYKEIT YQQYLQLQPE QQEKYLALCQ KDFEQETERI AFDRQGGVPG

      51  IARKFAQEEV AWFDRVTTWS YMNAYIPSYR RRRNLLKIDM LKMSNAEEY*