SOF1/YLL011W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YLL011W_S288C   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_AWRI1631   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_AWRI796   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_BC187   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_BY4741   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_BY4742   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_CBS7960   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_CEN.PK   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_CLIB215   
   --------------------------------------------------   
YLL011W_CLIB324   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_D273-10B   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_DBVPG6044   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_EC1118   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_EC9-8   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_FL100   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_FY1679   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_FostersB   1   MKXKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERXXEYTKALNATKL   50
YLL011W_FostersO   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_JAY291   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_JK9-3d   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_K11   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_Kyokai7   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_L1528   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_LalvinQA23   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_M22   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_RM11-1a   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_RedStar   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_SEY6210   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_SK1   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_T7   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_T73   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_UC5   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_UWOPS05_217_3   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_VL3   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_Vin13   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_W303   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_X2180-1A   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_Y55   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_YJM339   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_YJM789   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_YPH499   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_YPS128   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_YPS163   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_YS9   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
YLL011W_ZTW1   1   MKIKTIKRSADDYVPVKSTQESQMPRNLNPELHPFERAREYTKALNATKL   50
         

YLL011W_S288C   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_AWRI1631   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_AWRI796   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_BC187   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_BY4741   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_BY4742   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_CBS7960   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_CEN.PK   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_CLIB215   
   --------------------------------------------------   
YLL011W_CLIB324   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_D273-10B   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_DBVPG6044   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_EC1118   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_EC9-8   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_FL100   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_FY1679   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_FostersB   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSXDGVIKYWNMSTR   100
YLL011W_FostersO   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_JAY291   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_JK9-3d   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_K11   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_Kyokai7   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_L1528   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_LalvinQA23   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_M22   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_RM11-1a   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_RedStar   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_SEY6210   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_SK1   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_T7   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_T73   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_UC5   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_UWOPS05_217_3   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_VL3   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_Vin13   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_W303   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_X2180-1A   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_Y55   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_YJM339   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_YJM789   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_YPH499   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_YPS128   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_YPS163   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_YS9   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
YLL011W_ZTW1   51   ERMFAKPFVGQLGYGHRDGVYAIAKNYGSLNKLATGSADGVIKYWNMSTR   100
         

YLL011W_S288C   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_AWRI1631   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_AWRI796   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_BC187   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_BY4741   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_BY4742   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_CBS7960   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_CEN.PK   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_CLIB215   
   --------------------------------------------------   
YLL011W_CLIB324   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_D273-10B   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_DBVPG6044   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_EC1118   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_EC9-8   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_FL100   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_FY1679   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_FostersB   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_FostersO   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_JAY291   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_JK9-3d   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_K11   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_Kyokai7   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_L1528   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_LalvinQA23   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_M22   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_RM11-1a   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_RedStar   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_SEY6210   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_SK1   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_T7   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_T73   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_UC5   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_UWOPS05_217_3   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQDFMLSCSDDKTVKLWSI   150
YLL011W_VL3   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_Vin13   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_W303   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_X2180-1A   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_Y55   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_YJM339   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_YJM789   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSM   150
YLL011W_YPH499   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_YPS128   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_YPS163   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_YS9   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
YLL011W_ZTW1   101   EEFVSFKAHYGLVTGLCVTQPRFHDKKPDLKSQNFMLSCSDDKTVKLWSI   150
         

YLL011W_S288C   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_AWRI1631   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_AWRI796   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_BC187   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_BY4741   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_BY4742   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_CBS7960   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_CEN.PK   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_CLIB215   
   --------------------------------------------------   
YLL011W_CLIB324   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_D273-10B   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_DBVPG6044   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_EC1118   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_EC9-8   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_FL100   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_FY1679   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_FostersB   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_FostersO   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_JAY291   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_JK9-3d   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_K11   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAM   200
YLL011W_Kyokai7   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_L1528   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_LalvinQA23   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_M22   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_RM11-1a   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_RedStar   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_SEY6210   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_SK1   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_T7   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_T73   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_UC5   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_UWOPS05_217_3   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSMFATGGAK   200
YLL011W_VL3   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_Vin13   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_W303   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_X2180-1A   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_Y55   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_YJM339   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_YJM789   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_YPH499   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_YPS128   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_YPS163   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_YS9   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAK   200
YLL011W_ZTW1   151   NVDDYSNKNSSDNDSVTNEEGLIRTFDGESAFQGIDSHRENSTFATGGAM   200
         

YLL011W_S288C   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_AWRI1631   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_AWRI796   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_BC187   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_BY4741   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_BY4742   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_CBS7960   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_CEN.PK   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_CLIB215   
   --------------------------------------------------   
YLL011W_CLIB324   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_D273-10B   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_DBVPG6044   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_EC1118   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_EC9-8   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_FL100   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_FY1679   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_FostersB   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_FostersO   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_JAY291   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_JK9-3d   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_K11   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_Kyokai7   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_L1528   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_LalvinQA23   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_M22   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_RM11-1a   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_RedStar   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_SEY6210   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_SK1   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_T7   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_T73   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_UC5   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_UWOPS05_217_3   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_VL3   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_Vin13   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_W303   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_X2180-1A   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_Y55   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_YJM339   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_YJM789   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_YPH499   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_YPS128   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_YPS163   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_YS9   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
YLL011W_ZTW1   201   IHLWDVNRLKPVSDLSWGADNITSLKFNQNETDILASTGSDNSIVLYDLR   250
         

YLL011W_S288C   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_AWRI1631   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_AWRI796   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_BC187   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_BY4741   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_BY4742   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_CBS7960   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_CEN.PK   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_CLIB215   1   -----------MRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   39
YLL011W_CLIB324   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_D273-10B   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_DBVPG6044   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_EC1118   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_EC9-8   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_FL100   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_FY1679   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_FostersB   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_FostersO   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_JAY291   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_JK9-3d   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_K11   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_Kyokai7   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_L1528   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_LalvinQA23   251   TNSPTQKIVQTMRTNAICWNPMEAFNXVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_M22   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_RM11-1a   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_RedStar   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_SEY6210   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_SK1   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_T7   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_T73   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_UC5   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_UWOPS05_217_3   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_VL3   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_Vin13   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_W303   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_X2180-1A   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_Y55   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_YJM339   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_YJM789   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_YPH499   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_YPS128   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_YPS163   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_YS9   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
YLL011W_ZTW1   251   TNSPTQKIVQTMRTNAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNV   300
         

YLL011W_S288C   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_AWRI1631   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_AWRI796   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_BC187   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_BY4741   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_BY4742   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_CBS7960   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_CEN.PK   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_CLIB215   40   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   89
YLL011W_CLIB324   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_D273-10B   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_DBVPG6044   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_EC1118   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_EC9-8   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_FL100   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_FY1679   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_FostersB   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_FostersO   301   FKDHVSAVMDVDFSPTGG--------------------------------   318
YLL011W_JAY291   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_JK9-3d   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_K11   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_Kyokai7   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_L1528   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_LalvinQA23   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_M22   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_RM11-1a   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_RedStar   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_SEY6210   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_SK1   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_T7   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_T73   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_UC5   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_UWOPS05_217_3   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_VL3   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_Vin13   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_W303   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_X2180-1A   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_Y55   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_YJM339   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_YJM789   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_YPH499   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_YPS128   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_YPS163   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_YS9   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
YLL011W_ZTW1   301   FKDHVSAVMDVDFSPTGDEIVTGSYDKSIRIYKTNHGHSREIYHTKRMQH   350
         

YLL011W_S288C   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_AWRI1631   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_AWRI796   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_BC187   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_BY4741   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_BY4742   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_CBS7960   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_CEN.PK   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_CLIB215   90   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   139
YLL011W_CLIB324   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_D273-10B   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_DBVPG6044   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_EC1118   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDDKL   400
YLL011W_EC9-8   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_FL100   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_FY1679   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_FostersB   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_FostersO   
   --------------------------------------------------   
YLL011W_JAY291   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_JK9-3d   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_K11   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_Kyokai7   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_L1528   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_LalvinQA23   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDXKL   400
YLL011W_M22   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_RM11-1a   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_RedStar   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_SEY6210   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_SK1   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_T7   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_T73   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_UC5   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_UWOPS05_217_3   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_VL3   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_Vin13   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDDKL   400
YLL011W_W303   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_X2180-1A   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_Y55   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_YJM339   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_YJM789   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKF   400
YLL011W_YPH499   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_YPS128   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_YPS163   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_YS9   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
YLL011W_ZTW1   351   VFQVKYSMDSKYIISGSDDGNVRLWRSKAWERSNVKTTREKNKLEYDEKL   400
         

YLL011W_S288C   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_AWRI1631   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_AWRI796   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_BC187   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_BY4741   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_BY4742   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_CBS7960   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_CEN.PK   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_CLIB215   140   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   189
YLL011W_CLIB324   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_D273-10B   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_DBVPG6044   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_EC1118   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_EC9-8   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_FL100   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_FY1679   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_FostersB   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_FostersO   
   --------------------------------------------------   
YLL011W_JAY291   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_JK9-3d   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_K11   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_Kyokai7   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_L1528   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_LalvinQA23   401   KRKI----------------------------------------------   404
YLL011W_M22   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_RM11-1a   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_RedStar   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_SEY6210   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_SK1   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_T7   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_T73   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_UC5   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_UWOPS05_217_3   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_VL3   401   KERFRHMPEIKRISRHRHVPQVIQKGSGN---------------------   429
YLL011W_Vin13   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_W303   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_X2180-1A   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_Y55   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_YJM339   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_YJM789   401   KRKI----------------------------------------------   404
YLL011W_YPH499   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_YPS128   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_YPS163   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_YS9   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
YLL011W_ZTW1   401   KERFRHMPEIKRISRHRHVPQVIKKAQEIKNIELSSIKRREANERRTRKD   450
         

YLL011W_S288C   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_AWRI1631   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_AWRI796   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_BC187   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_BY4741   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_BY4742   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_CBS7960   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_CEN.PK   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_CLIB215   190   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   228
YLL011W_CLIB324   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_D273-10B   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_DBVPG6044   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_EC1118   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_EC9-8   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_FL100   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_FY1679   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_FostersB   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_FostersO   
   ---------------------------------------   
YLL011W_JAY291   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_JK9-3d   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_K11   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_Kyokai7   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_L1528   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_LalvinQA23   
   ---------------------------------------   
YLL011W_M22   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_RM11-1a   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_RedStar   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_SEY6210   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_SK1   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_T7   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_T73   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_UC5   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_UWOPS05_217_3   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_VL3   
   ---------------------------------------   
YLL011W_Vin13   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_W303   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_X2180-1A   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_Y55   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_YJM339   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_YJM789   
   ---------------------------------------   
YLL011W_YPH499   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_YPS128   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_YPS163   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_YS9   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
YLL011W_ZTW1   451   MPYISERKKQIVGTVHKYEDSGRDRKRRKEDDKRDTQEK   489
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YLL011W_S288C from SGD:

YLL011W_S288C [source=SGD]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_AWRI1631 from AWRI:

YLL011W_AWRI1631 [source=AWRI]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_AWRI796 from AWRI:

YLL011W_AWRI796 [source=AWRI]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_BC187 from Stanford:

YLL011W_BC187 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_BY4741 from Stanford:

YLL011W_BY4741 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_BY4742 from Stanford:

YLL011W_BY4742 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_CBS7960 from WashU:

YLL011W_CBS7960 [source=WashU]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_CEN.PK from Stanford:

YLL011W_CEN.PK [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_CLIB215 from WashU:

YLL011W_CLIB215 [source=WashU]  Length: 229  Fri Sep 22 21:35:29 2017  Type: P  Check: 8310  ..

       1  MRTNAICWNP MEAFNFVTAN EDHNAYYYDM RNLSRSLNVF KDHVSAVMDV

      51  DFSPTGDEIV TGSYDKSIRI YKTNHGHSRE IYHTKRMQHV FQVKYSMDSK

     101  YIISGSDDGN VRLWRSKAWE RSNVKTTREK NKLEYDEKLK ERFRHMPEIK

     151  RISRHRHVPQ VIKKAQEIKN IELSSIKRRE ANERRTRKDM PYISERKKQI

     201  VGTVHKYEDS GRDRKRRKED DKRDTQEK*

Protein Sequence for YLL011W_CLIB324 from WashU:

YLL011W_CLIB324 [source=WashU]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_D273-10B from Stanford:

YLL011W_D273-10B [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_DBVPG6044 from Stanford:

YLL011W_DBVPG6044 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_EC1118 from Genoscope:

YLL011W_EC1118 [source=Genoscope]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8748  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDDKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_EC9-8 from ASinica:

YLL011W_EC9-8 [source=ASinica]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_FL100 from Stanford:

YLL011W_FL100 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_FY1679 from Stanford:

YLL011W_FY1679 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_FostersB from AWRI:

YLL011W_FostersB [source=AWRI]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 670  ..

       1  MKXKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERXXE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSXDG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_FostersO from AWRI:

YLL011W_FostersO [source=AWRI]  Length: 319  Fri Sep 22 21:35:29 2017  Type: P  Check: 7016  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGG*

Protein Sequence for YLL011W_JAY291 from Duke:

YLL011W_JAY291 [source=Duke]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_JK9-3d from Stanford:

YLL011W_JK9-3d [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_K11 from Stanford:

YLL011W_K11 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8862  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAM

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_Kyokai7 from NRIB:

YLL011W_Kyokai7 [source=NRIB]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_L1528 from Stanford:

YLL011W_L1528 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_LalvinQA23 from AWRI:

YLL011W_LalvinQA23 [source=AWRI]  Length: 405  Fri Sep 22 21:35:29 2017  Type: P  Check: 1299  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNXVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDXKL

     401  KRKI*

Protein Sequence for YLL011W_M22 from WashU:

YLL011W_M22 [source=WashU]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_RM11-1a from Stanford:

YLL011W_RM11-1a [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_RedStar from Stanford:

YLL011W_RedStar [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_SEY6210 from Stanford:

YLL011W_SEY6210 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_SK1 from Stanford:

YLL011W_SK1 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_T7 from WashU:

YLL011W_T7 [source=WashU]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_T73 from WashU:

YLL011W_T73 [source=WashU]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_UC5 from WashU:

YLL011W_UC5 [source=WashU]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_UWOPS05_217_3 from Stanford:

YLL011W_UWOPS05_217_3 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8450  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQDFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSMFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_VL3 from AWRI:

YLL011W_VL3 [source=AWRI]  Length: 430  Fri Sep 22 21:35:29 2017  Type: P  Check: 5342  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIQKGSGN*

Protein Sequence for YLL011W_Vin13 from AWRI:

YLL011W_Vin13 [source=AWRI]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8748  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDDKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_W303 from Stanford:

YLL011W_W303 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_X2180-1A from Stanford:

YLL011W_X2180-1A [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_Y55 from Stanford:

YLL011W_Y55 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_YJM339 from Stanford:

YLL011W_YJM339 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_YJM789 from Stanford:

YLL011W_YJM789 [source=Stanford]  Length: 405  Fri Sep 22 21:35:29 2017  Type: P  Check: 9491  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSM

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKF

     401  KRKI*

Protein Sequence for YLL011W_YPH499 from Stanford:

YLL011W_YPH499 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_YPS128 from Stanford:

YLL011W_YPS128 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_YPS163 from Stanford:

YLL011W_YPS163 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_YS9 from Stanford:

YLL011W_YS9 [source=Stanford]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8804  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAK

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*

Protein Sequence for YLL011W_ZTW1 from Zhejiang:

YLL011W_ZTW1 [source=Zhejiang]  Length: 490  Fri Sep 22 21:35:29 2017  Type: P  Check: 8862  ..

       1  MKIKTIKRSA DDYVPVKSTQ ESQMPRNLNP ELHPFERARE YTKALNATKL

      51  ERMFAKPFVG QLGYGHRDGV YAIAKNYGSL NKLATGSADG VIKYWNMSTR

     101  EEFVSFKAHY GLVTGLCVTQ PRFHDKKPDL KSQNFMLSCS DDKTVKLWSI

     151  NVDDYSNKNS SDNDSVTNEE GLIRTFDGES AFQGIDSHRE NSTFATGGAM

     201  IHLWDVNRLK PVSDLSWGAD NITSLKFNQN ETDILASTGS DNSIVLYDLR

     251  TNSPTQKIVQ TMRTNAICWN PMEAFNFVTA NEDHNAYYYD MRNLSRSLNV

     301  FKDHVSAVMD VDFSPTGDEI VTGSYDKSIR IYKTNHGHSR EIYHTKRMQH

     351  VFQVKYSMDS KYIISGSDDG NVRLWRSKAW ERSNVKTTRE KNKLEYDEKL

     401  KERFRHMPEI KRISRHRHVP QVIKKAQEIK NIELSSIKRR EANERRTRKD

     451  MPYISERKKQ IVGTVHKYED SGRDRKRRKE DDKRDTQEK*