RPL40B/YKR094C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YKR094C_S288C   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_AWRI1631   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_AWRI796   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_BC187   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_BY4742   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_CBS7960   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_CEN.PK   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_CLIB215   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_CLIB324   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_EC1118   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_EC9-8   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_FostersB   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_FostersO   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_JAY291   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_Kyokai7   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_LalvinQA23   1   MQIFVKTLTGKTITLEVESSDTIXNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_T7   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_UC5   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_VL3   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_Vin13   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_YJM269   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_YJM339   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGXPPDQQRLIFAGKQL   50
YKR094C_YJM789   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
YKR094C_ZTW1   1   MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL   50
         

YKR094C_S288C   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_AWRI1631   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_AWRI796   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_BC187   51   EDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID   100
YKR094C_BY4742   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_CBS7960   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_CEN.PK   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_CLIB215   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_CLIB324   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_EC1118   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_EC9-8   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_FostersB   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_FostersO   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_JAY291   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_Kyokai7   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_LalvinQA23   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_T7   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_UC5   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_VL3   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_Vin13   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_YJM269   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_YJM339   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_YJM789   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
YKR094C_ZTW1   51   EDGRTLSDYNIQKESTLHLVLRLRG-------------------------   75
         

YKR094C_S288C   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_AWRI1631   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_AWRI796   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_BC187   101   NVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR   150
YKR094C_BY4742   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_CBS7960   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_CEN.PK   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_CLIB215   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_CLIB324   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_EC1118   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_EC9-8   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_FostersB   76   ----------GIIEPSLKALAS-----------KYNCDKSVXRKCYARLP   104
YKR094C_FostersO   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_JAY291   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_Kyokai7   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_LalvinQA23   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_T7   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_UC5   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_VL3   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_Vin13   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_YJM269   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_YJM339   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_YJM789   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
YKR094C_ZTW1   76   ----------GIIEPSLKALAS-----------KYNCDKSVCRKCYARLP   104
         

YKR094C_S288C   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_AWRI1631   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_AWRI796   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_BC187   151   GGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK   200
YKR094C_BY4742   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_CBS7960   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_CEN.PK   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_CLIB215   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_CLIB324   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_EC1118   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_EC9-8   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_FostersB   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_FostersO   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_JAY291   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_Kyokai7   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_LalvinQA23   105   PRATNCRKRKCGHXNQLRPKKKLK--------------------------   128
YKR094C_T7   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_UC5   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_VL3   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_Vin13   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_YJM269   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_YJM339   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_YJM789   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
YKR094C_ZTW1   105   PRATNCRKRKCGHTNQLRPKKKLK--------------------------   128
         

YKR094C_S288C   
   --------------------------------------------   
YKR094C_AWRI1631   
   --------------------------------------------   
YKR094C_AWRI796   
   --------------------------------------------   
YKR094C_BC187   201   QLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVXXXXXXXXXXG   244
YKR094C_BY4742   
   --------------------------------------------   
YKR094C_CBS7960   
   --------------------------------------------   
YKR094C_CEN.PK   
   --------------------------------------------   
YKR094C_CLIB215   
   --------------------------------------------   
YKR094C_CLIB324   
   --------------------------------------------   
YKR094C_EC1118   
   --------------------------------------------   
YKR094C_EC9-8   
   --------------------------------------------   
YKR094C_FostersB   
   --------------------------------------------   
YKR094C_FostersO   
   --------------------------------------------   
YKR094C_JAY291   
   --------------------------------------------   
YKR094C_Kyokai7   
   --------------------------------------------   
YKR094C_LalvinQA23   
   --------------------------------------------   
YKR094C_T7   
   --------------------------------------------   
YKR094C_UC5   
   --------------------------------------------   
YKR094C_VL3   
   --------------------------------------------   
YKR094C_Vin13   
   --------------------------------------------   
YKR094C_YJM269   
   --------------------------------------------   
YKR094C_YJM339   
   --------------------------------------------   
YKR094C_YJM789   
   --------------------------------------------   
YKR094C_ZTW1   
   --------------------------------------------   
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YKR094C_S288C from SGD:

YKR094C_S288C [source=SGD]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_AWRI1631 from AWRI:

YKR094C_AWRI1631 [source=AWRI]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_AWRI796 from AWRI:

YKR094C_AWRI796 [source=AWRI]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_BC187 from Stanford:

YKR094C_BC187 [source=Stanford]  Length: 245  Thu Sep 21 11:11:36 2017  Type: P  Check: 8472  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGMQIF VKTLTGKTIT LEVESSDTID

     101  NVKSKIQDKE GIPPDQQRLI FAGKQLEDGR TLSDYNIQKE STLHLVLRLR

     151  GGMQIFVKTL TGKTITLEVE SSDTIDNVKS KIQDKEGIPP DQQRLIFAGK

     201  QLEDGRTLSD YNIQKESTLH LVLRLRGGMQ IFVXXXXXXX XXXG*


Protein Sequence for YKR094C_BY4742 from Stanford:

YKR094C_BY4742 [source=Stanford]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_CBS7960 from WashU:

YKR094C_CBS7960 [source=WashU]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_CEN.PK from Stanford:

YKR094C_CEN.PK [source=Stanford]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_CLIB215 from WashU:

YKR094C_CLIB215 [source=WashU]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_CLIB324 from WashU:

YKR094C_CLIB324 [source=WashU]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_EC1118 from Genoscope:

YKR094C_EC1118 [source=Genoscope]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_EC9-8 from ASinica:

YKR094C_EC9-8 [source=ASinica]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_FostersB from AWRI:

YKR094C_FostersB [source=AWRI]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 1246  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVXRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_FostersO from AWRI:

YKR094C_FostersO [source=AWRI]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_JAY291 from Duke:

YKR094C_JAY291 [source=Duke]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_Kyokai7 from NRIB:

YKR094C_Kyokai7 [source=NRIB]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_LalvinQA23 from AWRI:

YKR094C_LalvinQA23 [source=AWRI]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 923  ..

       1  MQIFVKTLTG KTITLEVESS DTIXNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHXNQ LRPKKKLK*

Protein Sequence for YKR094C_T7 from WashU:

YKR094C_T7 [source=WashU]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_UC5 from WashU:

YKR094C_UC5 [source=WashU]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_VL3 from AWRI:

YKR094C_VL3 [source=AWRI]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_Vin13 from AWRI:

YKR094C_Vin13 [source=AWRI]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_YJM269 from WashU:

YKR094C_YJM269 [source=WashU]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_YJM339 from Stanford:

YKR094C_YJM339 [source=Stanford]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 967  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGXPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_YJM789 from Stanford:

YKR094C_YJM789 [source=Stanford]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*

Protein Sequence for YKR094C_ZTW1 from Zhejiang:

YKR094C_ZTW1 [source=Zhejiang]  Length: 129  Thu Sep 21 11:11:36 2017  Type: P  Check: 427  ..

       1  MQIFVKTLTG KTITLEVESS DTIDNVKSKI QDKEGIPPDQ QRLIFAGKQL

      51  EDGRTLSDYN IQKESTLHLV LRLRGGIIEP SLKALASKYN CDKSVCRKCY

     101  ARLPPRATNC RKRKCGHTNQ LRPKKKLK*