YKR070W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YKR070W_S288C   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_AWRI1631   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_AWRI796   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_BC187   1   MIGKRFFQITSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_BY4741   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_BY4742   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_CEN.PK   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_D273-10B   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_DBVPG6044   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_EC1118   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_EC9-8   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_FL100   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_FY1679   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_FostersB   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIXGASDALKLLNRNKIPYIL   50
YKR070W_FostersO   
   --------------------------------------------------   
YKR070W_JAY291   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_JK9-3d   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_K11   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_Kyokai7   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_L1528   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_LalvinQA23   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_PW5   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_RM11-1a   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_RedStar   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_SEY6210   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_SK1   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_T7   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_UC5   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_UWOPS05_217_3   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_VL3   
   --------------------------------------------------   
YKR070W_Vin13   
   --------------------------------------------------   
YKR070W_W303   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_X2180-1A   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_Y55   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_YJM269   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_YJM339   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_YJM789   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_YPH499   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_YPS128   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_YPS163   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_YS9   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
YKR070W_ZTW1   1   MIGKRFFQTTSKKIAFAFDIDGVLFRGKKPIAGASDALKLLNRNKIPYIL   50
         

YKR070W_S288C   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_AWRI1631   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_AWRI796   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_BC187   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_BY4741   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_BY4742   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_CEN.PK   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_D273-10B   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_DBVPG6044   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_EC1118   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_EC9-8   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_FL100   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_FY1679   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_FostersB   51   LTNGGGFSERARTEFXSSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_FostersO   
   --------------------------------------------------   
YKR070W_JAY291   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_JK9-3d   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_K11   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_Kyokai7   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_L1528   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_LalvinQA23   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_PW5   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_RM11-1a   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_RedStar   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_SEY6210   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_SK1   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_T7   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_UC5   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_UWOPS05_217_3   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_VL3   1   --------------------------------------MPSWYLTILMIG   12
YKR070W_Vin13   
   --------------------------------------------------   
YKR070W_W303   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_X2180-1A   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_Y55   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_YJM269   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_YJM339   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_YJM789   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_YPH499   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_YPS128   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_YPS163   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_YS9   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
YKR070W_ZTW1   51   LTNGGGFSERARTEFISSKLDVDVSPLQIIQSHTPYKSLVNKYSRILAVG   100
         

YKR070W_S288C   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_AWRI1631   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQMMEYSRDIPDL   150
YKR070W_AWRI796   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQMMEYSRDIPDL   150
YKR070W_BC187   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_BY4741   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_BY4742   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_CEN.PK   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_D273-10B   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_DBVPG6044   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_EC1118   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_EC9-8   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_FL100   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_FY1679   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_FostersB   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_FostersO   1   ----------------------------------------MEYSRDIPDL   10
YKR070W_JAY291   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_JK9-3d   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_K11   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_Kyokai7   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_L1528   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQMMEYSRDIPDL   150
YKR070W_LalvinQA23   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_PW5   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_RM11-1a   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_RedStar   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_SEY6210   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_SK1   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_T7   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_UC5   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_UWOPS05_217_3   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_VL3   13   LP------------------------------------------------   14
YKR070W_Vin13   1   ----------------------------------------MEYSRDIPDL   10
YKR070W_W303   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_X2180-1A   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_Y55   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_YJM269   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_YJM339   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_YJM789   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQMMEYSRDIPDL   150
YKR070W_YPH499   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_YPS128   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_YPS163   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_YS9   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
YKR070W_ZTW1   101   TPSVRGVAEGYGFQDVVHQTDIVRYNRDIAPFSGLSDEQVMEYSRDIPDL   150
         

YKR070W_S288C   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_AWRI1631   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_AWRI796   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_BC187   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_BY4741   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_BY4742   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_CEN.PK   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_D273-10B   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_DBVPG6044   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_EC1118   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_EC9-8   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_FL100   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_FY1679   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_FostersB   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_FostersO   11   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   60
YKR070W_JAY291   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_JK9-3d   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_K11   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_Kyokai7   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_L1528   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_LalvinQA23   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_PW5   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_RM11-1a   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_RedStar   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_SEY6210   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_SK1   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_T7   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_UC5   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_UWOPS05_217_3   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_VL3   15   -------------------IYKIISDAINSENGMLNTLRNEKSGKPSIPI   45
YKR070W_Vin13   11   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   60
YKR070W_W303   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_X2180-1A   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_Y55   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_YJM269   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_YJM339   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_YJM789   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_YPH499   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_YPS128   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_YPS163   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_YS9   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
YKR070W_ZTW1   151   TTKKFDAVLVFNDPHDWAADIQIISDAINSENGMLNTLRNEKSGKPSIPI   200
         

YKR070W_S288C   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_AWRI1631   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_AWRI796   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_BC187   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_BY4741   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_BY4742   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_CEN.PK   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_D273-10B   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_DBVPG6044   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_EC1118   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_EC9-8   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_FL100   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_FY1679   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_FostersB   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_FostersO   61   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   110
YKR070W_JAY291   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_JK9-3d   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_K11   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_Kyokai7   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_L1528   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_LalvinQA23   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_PW5   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_RM11-1a   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_RedStar   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_SEY6210   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_SK1   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_T7   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_UC5   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_UWOPS05_217_3   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_VL3   46   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   95
YKR070W_Vin13   61   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   110
YKR070W_W303   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_X2180-1A   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_Y55   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_YJM269   201   YFSNQDLLWANSYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_YJM339   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_YJM789   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_YPH499   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_YPS128   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_YPS163   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_YS9   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
YKR070W_ZTW1   201   YFSNQDLLWANPYKLNRFGQGAFRLLVRRLYLELNGEPLQDYTLGKPTKL   250
         

YKR070W_S288C   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_AWRI1631   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_AWRI796   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_BC187   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_BY4741   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_BY4742   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_CEN.PK   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_D273-10B   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_DBVPG6044   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_EC1118   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_EC9-8   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_FL100   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_FY1679   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_FostersB   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_FostersO   111   TYDFAHHVLIDWEKKTKRENRPICEAKTATLRHETFNFSIPCGFYGR---   157
YKR070W_JAY291   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_JK9-3d   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_K11   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_Kyokai7   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_L1528   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_LalvinQA23   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_PW5   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_RM11-1a   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_RedStar   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_SEY6210   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_SK1   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_T7   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_UC5   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_UWOPS05_217_3   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_VL3   96   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   145
YKR070W_Vin13   111   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   160
YKR070W_W303   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_X2180-1A   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_Y55   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_YJM269   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_YJM339   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_YJM789   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_YPH499   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_YPS128   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_YPS163   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_YS9   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
YKR070W_ZTW1   251   TYDFAHHVLIDWEKRLSGKIGQSVKQKLPLLGTKPSTSPFHAVFMVGDNP   300
         

YKR070W_S288C   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_AWRI1631   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_AWRI796   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_BC187   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_BY4741   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_BY4742   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_CEN.PK   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_D273-10B   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_DBVPG6044   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_EC1118   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_EC9-8   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_FL100   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_FY1679   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_FostersB   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_FostersO   
   --------------------------------------------------   
YKR070W_JAY291   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_JK9-3d   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_K11   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_Kyokai7   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_L1528   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_LalvinQA23   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_PW5   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_RM11-1a   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_RedStar   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_SEY6210   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_SK1   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_T7   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_UC5   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_UWOPS05_217_3   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_VL3   146   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   195
YKR070W_Vin13   161   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   210
YKR070W_W303   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_X2180-1A   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_Y55   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_YJM269   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_YJM339   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_YJM789   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_YPH499   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_YPS128   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_YPS163   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_YS9   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
YKR070W_ZTW1   301   ASDIIGAQNYGWNSCLVKTGVYNEGDDLKECKPTLIVNDVFDAVTKTLEK   350
         

YKR070W_S288C   351   YA   352
YKR070W_AWRI1631   351   YA   352
YKR070W_AWRI796   351   YA   352
YKR070W_BC187   351   YA   352
YKR070W_BY4741   351   YA   352
YKR070W_BY4742   351   YA   352
YKR070W_CEN.PK   351   YA   352
YKR070W_D273-10B   351   YA   352
YKR070W_DBVPG6044   351   YA   352
YKR070W_EC1118   351   YA   352
YKR070W_EC9-8   351   YA   352
YKR070W_FL100   351   YA   352
YKR070W_FY1679   351   YA   352
YKR070W_FostersB   351   YA   352
YKR070W_FostersO   
   --   
YKR070W_JAY291   351   YA   352
YKR070W_JK9-3d   351   YA   352
YKR070W_K11   351   YA   352
YKR070W_Kyokai7   351   YA   352
YKR070W_L1528   351   YA   352
YKR070W_LalvinQA23   351   YA   352
YKR070W_PW5   351   YA   352
YKR070W_RM11-1a   351   YA   352
YKR070W_RedStar   351   YA   352
YKR070W_SEY6210   351   YA   352
YKR070W_SK1   351   YA   352
YKR070W_T7   351   YA   352
YKR070W_UC5   351   YA   352
YKR070W_UWOPS05_217_3   351   YA   352
YKR070W_VL3   196   YA   197
YKR070W_Vin13   211   YA   212
YKR070W_W303   351   YA   352
YKR070W_X2180-1A   351   YA   352
YKR070W_Y55   351   YA   352
YKR070W_YJM269   351   YA   352
YKR070W_YJM339   351   YA   352
YKR070W_YJM789   351   YA   352
YKR070W_YPH499   351   YA   352
YKR070W_YPS128   351   YA   352
YKR070W_YPS163   351   YA   352
YKR070W_YS9   351   YA   352
YKR070W_ZTW1   351   YA   352
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YKR070W_S288C from SGD:

YKR070W_S288C [source=SGD]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_AWRI1631 from AWRI:

YKR070W_AWRI1631 [source=AWRI]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 982  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQM MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_AWRI796 from AWRI:

YKR070W_AWRI796 [source=AWRI]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 982  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQM MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_BC187 from Stanford:

YKR070W_BC187 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1117  ..

       1  MIGKRFFQIT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_BY4741 from Stanford:

YKR070W_BY4741 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_BY4742 from Stanford:

YKR070W_BY4742 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_CEN.PK from Stanford:

YKR070W_CEN.PK [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_D273-10B from Stanford:

YKR070W_D273-10B [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_DBVPG6044 from Stanford:

YKR070W_DBVPG6044 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_EC1118 from Genoscope:

YKR070W_EC1118 [source=Genoscope]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_EC9-8 from ASinica:

YKR070W_EC9-8 [source=ASinica]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_FL100 from Stanford:

YKR070W_FL100 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_FY1679 from Stanford:

YKR070W_FY1679 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_FostersB from AWRI:

YKR070W_FostersB [source=AWRI]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 2087  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IXGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFXSSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_FostersO from AWRI:

YKR070W_FostersO [source=AWRI]  Length: 158  Fri Jul 20 11:26:04 2018  Type: P  Check: 6030  ..

       1  MEYSRDIPDL TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN

      51  EKSGKPSIPI YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ

     101  DYTLGKPTKL TYDFAHHVLI DWEKKTKREN RPICEAKTAT LRHETFNFSI

     151  PCGFYGR*

Protein Sequence for YKR070W_JAY291 from Duke:

YKR070W_JAY291 [source=Duke]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_JK9-3d from Stanford:

YKR070W_JK9-3d [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_K11 from Stanford:

YKR070W_K11 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_Kyokai7 from NRIB:

YKR070W_Kyokai7 [source=NRIB]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_L1528 from Stanford:

YKR070W_L1528 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 982  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQM MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_LalvinQA23 from AWRI:

YKR070W_LalvinQA23 [source=AWRI]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_PW5 from WashU:

YKR070W_PW5 [source=WashU]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_RM11-1a from Stanford:

YKR070W_RM11-1a [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_RedStar from Stanford:

YKR070W_RedStar [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_SEY6210 from Stanford:

YKR070W_SEY6210 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_SK1 from Stanford:

YKR070W_SK1 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_T7 from WashU:

YKR070W_T7 [source=WashU]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_UC5 from WashU:

YKR070W_UC5 [source=WashU]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_UWOPS05_217_3 from Stanford:

YKR070W_UWOPS05_217_3 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_VL3 from AWRI:

YKR070W_VL3 [source=AWRI]  Length: 198  Fri Jul 20 11:26:04 2018  Type: P  Check: 8045  ..

       1  MPSWYLTILM IGLPIYKIIS DAINSENGML NTLRNEKSGK PSIPIYFSNQ

      51  DLLWANPYKL NRFGQGAFRL LVRRLYLELN GEPLQDYTLG KPTKLTYDFA

     101  HHVLIDWEKR LSGKIGQSVK QKLPLLGTKP STSPFHAVFM VGDNPASDII

     151  GAQNYGWNSC LVKTGVYNEG DDLKECKPTL IVNDVFDAVT KTLEKYA*


Protein Sequence for YKR070W_Vin13 from AWRI:

YKR070W_Vin13 [source=AWRI]  Length: 213  Fri Jul 20 11:26:04 2018  Type: P  Check: 5746  ..

       1  MEYSRDIPDL TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN

      51  EKSGKPSIPI YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ

     101  DYTLGKPTKL TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF

     151  HAVFMVGDNP ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV

     201  FDAVTKTLEK YA*

Protein Sequence for YKR070W_W303 from Stanford:

YKR070W_W303 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_X2180-1A from Stanford:

YKR070W_X2180-1A [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_Y55 from Stanford:

YKR070W_Y55 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_YJM269 from WashU:

YKR070W_YJM269 [source=WashU]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1339  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NSYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_YJM339 from Stanford:

YKR070W_YJM339 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_YJM789 from Stanford:

YKR070W_YJM789 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 982  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQM MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_YPH499 from Stanford:

YKR070W_YPH499 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_YPS128 from Stanford:

YKR070W_YPS128 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_YPS163 from Stanford:

YKR070W_YPS163 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_YS9 from Stanford:

YKR070W_YS9 [source=Stanford]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*

Protein Sequence for YKR070W_ZTW1 from Zhejiang:

YKR070W_ZTW1 [source=Zhejiang]  Length: 353  Fri Jul 20 11:26:04 2018  Type: P  Check: 1216  ..

       1  MIGKRFFQTT SKKIAFAFDI DGVLFRGKKP IAGASDALKL LNRNKIPYIL

      51  LTNGGGFSER ARTEFISSKL DVDVSPLQII QSHTPYKSLV NKYSRILAVG

     101  TPSVRGVAEG YGFQDVVHQT DIVRYNRDIA PFSGLSDEQV MEYSRDIPDL

     151  TTKKFDAVLV FNDPHDWAAD IQIISDAINS ENGMLNTLRN EKSGKPSIPI

     201  YFSNQDLLWA NPYKLNRFGQ GAFRLLVRRL YLELNGEPLQ DYTLGKPTKL

     251  TYDFAHHVLI DWEKRLSGKI GQSVKQKLPL LGTKPSTSPF HAVFMVGDNP

     301  ASDIIGAQNY GWNSCLVKTG VYNEGDDLKE CKPTLIVNDV FDAVTKTLEK

     351  YA*