CCP1/YKR066C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YKR066C_S288C   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_AWRI1631   
   --------------------------------------------------   
YKR066C_AWRI796   
   --------------------------------------------------   
YKR066C_BC187   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_BY4741   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_BY4742   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_CBS7960   
   --------------------------------------------------   
YKR066C_CEN.PK   1   MTTAVRFLPSLGRTAHKRSLYLFS--AAAAAAAAAAATFAYSQSHKRSSS   48
YKR066C_CLIB215   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_D273-10B   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_DBVPG6044   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSHKRSSS   46
YKR066C_EC1118   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_EC9-8   1   MTTAVRLLPSLGRTAHKRSLYLFS-------AAAAAATFAYSQSHKRSSS   43
YKR066C_FL100   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_FY1679   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_FostersB   
   --------------------------------------------------   
YKR066C_FostersO   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_JAY291   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSHKRSSS   46
YKR066C_JK9-3d   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_K11   1   MTTAVRLLPSLGRTAHKRSLYLFS--AAAAAAAAAAATFAYSQSHKRSSS   48
YKR066C_Kyokai7   1   MTTAVRLLPSLGRTAHKRSLYLFS--AAAAAAAAAAATFAYSQSHKRSSS   48
YKR066C_L1528   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_LalvinQA23   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_PW5   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSHKRSSS   46
YKR066C_RM11-1a   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_RedStar   1   MTTAVRFLPSLGRTAHKRSLYLFS--AAAAAAAAAAATFAYSQSHKRSSS   48
YKR066C_SEY6210   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_SK1   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSHKRSSS   46
YKR066C_T7   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSHKRSSS   46
YKR066C_T73   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSHKRSSS   46
YKR066C_UC5   1   MTTAVRLLPSLGRTAHKRSLYLFSAA--AAAAAAAAATFAYSQSHKRSSS   48
YKR066C_VL3   
   --------------------------------------------------   
YKR066C_Vin13   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_W303   1   MTTAVRLLPSLGRTAHKRSLYLFSA----AAAAAAAATFAYSQSHKRSSS   46
YKR066C_X2180-1A   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_Y10   1   MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAAAAAATFAYSQSHKRSSS   50
YKR066C_Y55   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSHKRSSS   46
YKR066C_YJM269   1   MTTAVRLLPSLGRTAHKRSLYLFSAAAAAAAAAAAAATFAYSQSHKRSSS   50
YKR066C_YJM339   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_YJM789   1   MTTAVRLLPSLGRTAHKRSLYLFS---AAAAAAAAAATFAYSQSHKRSSS   47
YKR066C_YPH499   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSQKRSSS   46
YKR066C_YPS128   1   MTTAVRLLPSLGRTAHKRSLYLFS----AAAAAAAAATFAYSQSHKRSSS   46
YKR066C_YPS163   1   MTTAVRLLPSLGRTAHKRSLYLFSA----AAAAAAAATFAYSQSHKRSSS   46
YKR066C_YS9   1   MTTAVRLLPSLGRTAHKRSLYLFS-------AAAAAATFAYSQSHKRSSS   43
YKR066C_ZTW1   1   MTTAVRLLPSLGRTAHKRSLYLFSAA--AAAAAAAAATFAYSQSHKRSSS   48
         

YKR066C_S288C   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_AWRI1631   
   --------------------------------------------------   
YKR066C_AWRI796   
   --------------------------------------------------   
YKR066C_BC187   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_BY4741   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_BY4742   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_CBS7960   
   --------------------------------------------------   
YKR066C_CEN.PK   49   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   98
YKR066C_CLIB215   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_D273-10B   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_DBVPG6044   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_EC1118   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_EC9-8   44   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   93
YKR066C_FL100   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_FY1679   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_FostersB   
   --------------------------------------------------   
YKR066C_FostersO   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_JAY291   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_JK9-3d   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_K11   49   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   98
YKR066C_Kyokai7   49   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   98
YKR066C_L1528   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_LalvinQA23   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_PW5   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_RM11-1a   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_RedStar   49   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   98
YKR066C_SEY6210   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_SK1   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_T7   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_T73   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_UC5   49   SPGGGSNHGWNNWGKAATLASTTPLVHVASVEKGRSYEDFQKVYNAIALK   98
YKR066C_VL3   
   --------------------------------------------------   
YKR066C_Vin13   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_W303   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_X2180-1A   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_Y10   51   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   100
YKR066C_Y55   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_YJM269   51   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   100
YKR066C_YJM339   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_YJM789   48   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   97
YKR066C_YPH499   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_YPS128   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_YPS163   47   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   96
YKR066C_YS9   44   SPGGGSNHGWNNWGKAAALASTTPLVHVASVEKGRSYEDFQKVYNAIALK   93
YKR066C_ZTW1   49   SPGGGSNHGWNNWGKAATLASTTPLVHVASVEKGRSYEDFQKVYNAIALK   98
         

YKR066C_S288C   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_AWRI1631   
   --------------------------------------------------   
YKR066C_AWRI796   
   --------------------------------------------------   
YKR066C_BC187   98   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_BY4741   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_BY4742   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_CBS7960   
   --------------------------------------------------   
YKR066C_CEN.PK   99   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   148
YKR066C_CLIB215   98   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_D273-10B   98   LREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_DBVPG6044   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_EC1118   98   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_EC9-8   94   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   143
YKR066C_FL100   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_FY1679   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_FostersB   
   --------------------------------------------------   
YKR066C_FostersO   98   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_JAY291   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_JK9-3d   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_K11   99   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   148
YKR066C_Kyokai7   99   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   148
YKR066C_L1528   98   LREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_LalvinQA23   98   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_PW5   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_RM11-1a   98   LREDDEYDNYIGYGPVLVRLAWHISGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_RedStar   99   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   148
YKR066C_SEY6210   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_SK1   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_T7   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_T73   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_UC5   99   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   148
YKR066C_VL3   
   --------------------------------------------------   
YKR066C_Vin13   98   LREDDEYDNYIGYGPVLVRLTWHTSGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_W303   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_X2180-1A   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_Y10   101   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   150
YKR066C_Y55   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_YJM269   101   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   150
YKR066C_YJM339   98   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_YJM789   98   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   147
YKR066C_YPH499   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_YPS128   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_YPS163   97   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   146
YKR066C_YS9   94   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   143
YKR066C_ZTW1   99   LREDDEYDNYIGYGPVLVRLAWHTSGTWDKHDNTGGSYGGTYRFKKEFND   148
         

YKR066C_S288C   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_AWRI1631   1   ---------------------------------------MQGPKIPWRCG   11
YKR066C_AWRI796   1   ---------------------------------------MQGPKIPWRCG   11
YKR066C_BC187   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_BY4741   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_BY4742   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_CBS7960   1   ---------------------------------------MQGPKIPWRCG   11
YKR066C_CEN.PK   149   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   198
YKR066C_CLIB215   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_D273-10B   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_DBVPG6044   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_EC1118   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_EC9-8   144   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   193
YKR066C_FL100   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_FY1679   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_FostersB   1   ---------------------------------------MQGPKIPWRCG   11
YKR066C_FostersO   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_JAY291   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_JK9-3d   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_K11   149   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   198
YKR066C_Kyokai7   149   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   198
YKR066C_L1528   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_LalvinQA23   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_PW5   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_RM11-1a   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_RedStar   149   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   198
YKR066C_SEY6210   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_SK1   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_T7   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_T73   147   PSNAGLQNGFKFLEPIHEEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_UC5   149   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   198
YKR066C_VL3   1   ---------------------------------------MQGPKIPWRCG   11
YKR066C_Vin13   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_W303   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_X2180-1A   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_Y10   151   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   200
YKR066C_Y55   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_YJM269   151   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   200
YKR066C_YJM339   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_YJM789   148   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   197
YKR066C_YPH499   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_YPS128   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_YPS163   147   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   196
YKR066C_YS9   144   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   193
YKR066C_ZTW1   149   PSNAGLQNGFKFLEPIHKEFPWISSGDLFSLGGVTAVQEMQGPKIPWRCG   198
         

YKR066C_S288C   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_AWRI1631   12   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   61
YKR066C_AWRI796   12   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   61
YKR066C_BC187   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_BY4741   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_BY4742   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_CBS7960   12   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   61
YKR066C_CEN.PK   199   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   248
YKR066C_CLIB215   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_D273-10B   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_DBVPG6044   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_EC1118   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_EC9-8   194   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   243
YKR066C_FL100   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_FY1679   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_FostersB   12   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   61
YKR066C_FostersO   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_JAY291   197   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_JK9-3d   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_K11   199   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   248
YKR066C_Kyokai7   199   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   248
YKR066C_L1528   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_LalvinQA23   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_PW5   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_RM11-1a   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_RedStar   199   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   248
YKR066C_SEY6210   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_SK1   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_T7   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_T73   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_UC5   199   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   248
YKR066C_VL3   12   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVXALMGAHALGK   61
YKR066C_Vin13   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_W303   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_X2180-1A   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_Y10   201   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   250
YKR066C_Y55   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_YJM269   201   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   250
YKR066C_YJM339   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_YJM789   198   RVDTPEDTTPDNGRLPDADKDAGYVRTFFQRLNMNDREVVALMGAHALGK   247
YKR066C_YPH499   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_YPS128   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_YPS163   197   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   246
YKR066C_YS9   194   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   243
YKR066C_ZTW1   199   RVDTPEDTTPDNGRLPDADKDADYVRTFFQRLNMNDREVVALMGAHALGK   248
         

YKR066C_S288C   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_AWRI1631   62   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   111
YKR066C_AWRI796   62   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   111
YKR066C_BC187   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_BY4741   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_BY4742   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_CBS7960   62   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   111
YKR066C_CEN.PK   249   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   298
YKR066C_CLIB215   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_D273-10B   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_DBVPG6044   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_EC1118   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_EC9-8   244   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   293
YKR066C_FL100   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_FY1679   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_FostersB   62   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWGSKSGY   111
YKR066C_FostersO   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWGSKSGY   297
YKR066C_JAY291   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_JK9-3d   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_K11   249   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   298
YKR066C_Kyokai7   249   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   298
YKR066C_L1528   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_LalvinQA23   248   THLKNSGYEGPWGAANNVFTNEFYLNLXNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_PW5   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_RM11-1a   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_RedStar   249   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   298
YKR066C_SEY6210   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_SK1   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_T7   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_T73   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_UC5   249   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   298
YKR066C_VL3   62   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   111
YKR066C_Vin13   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_W303   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_X2180-1A   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_Y10   251   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   300
YKR066C_Y55   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_YJM269   251   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   300
YKR066C_YJM339   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_YJM789   248   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   297
YKR066C_YPH499   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_YPS128   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_YPS163   247   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   296
YKR066C_YS9   244   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   293
YKR066C_ZTW1   249   THLKNSGYEGPWGAANNVFTNEFYLNLLNEDWKLEKNDANNEQWDSKSGY   298
         

YKR066C_S288C   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_AWRI1631   112   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   161
YKR066C_AWRI796   112   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   161
YKR066C_BC187   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_BY4741   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_BY4742   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_CBS7960   112   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   161
YKR066C_CEN.PK   299   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   348
YKR066C_CLIB215   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_D273-10B   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_DBVPG6044   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_EC1118   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_EC9-8   294   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   343
YKR066C_FL100   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_FY1679   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_FostersB   112   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   161
YKR066C_FostersO   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_JAY291   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_JK9-3d   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_K11   299   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   348
YKR066C_Kyokai7   299   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   348
YKR066C_L1528   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_LalvinQA23   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_PW5   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_RM11-1a   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_RedStar   299   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   348
YKR066C_SEY6210   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_SK1   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_T7   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_T73   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_UC5   299   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   348
YKR066C_VL3   112   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   161
YKR066C_Vin13   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_W303   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_X2180-1A   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_Y10   301   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   350
YKR066C_Y55   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_YJM269   301   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   350
YKR066C_YJM339   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_YJM789   298   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   347
YKR066C_YPH499   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_YPS128   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_YPS163   297   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   346
YKR066C_YS9   294   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   343
YKR066C_ZTW1   299   MMLPTDYSLIQDPKYLSIVKEYANDQDKFFKDFSKAFEKLLENGITFPKD   348
         

YKR066C_S288C   347   APSPFIFKTLEEQGL   361
YKR066C_AWRI1631   162   APSPFIFKTLEEQGL   176
YKR066C_AWRI796   162   APSPFIFKTLEEQGL   176
YKR066C_BC187   348   APSPFIFKTLEEQGL   362
YKR066C_BY4741   347   APSPFIFKTLEEQGL   361
YKR066C_BY4742   347   APSPFIFKTLEEQGL   361
YKR066C_CBS7960   162   APSPFIFKTLEEQGL   176
YKR066C_CEN.PK   349   APSPFIFKTLEEQGL   363
YKR066C_CLIB215   348   APSPFIFKTLEEQGL   362
YKR066C_D273-10B   348   APSPFIFKTLEEQGL   362
YKR066C_DBVPG6044   347   APSPFIFKTLEEQGL   361
YKR066C_EC1118   348   APSPFIFKTLEEQGL   362
YKR066C_EC9-8   344   APSPFIFKTLEEQGL   358
YKR066C_FL100   347   APSPFIFKTLEEQGL   361
YKR066C_FY1679   347   APSPFIFKTLEEQGL   361
YKR066C_FostersB   162   APSPFIFKTLEEQGL   176
YKR066C_FostersO   348   APSPFIFKTLEEQGL   362
YKR066C_JAY291   347   APSPFIFKTLEEQGL   361
YKR066C_JK9-3d   347   APSPFIFKTLEEQGL   361
YKR066C_K11   349   APSPFIFKTLEEQGL   363
YKR066C_Kyokai7   349   APSPFIFKTLEEQGL   363
YKR066C_L1528   348   APSPFIFKTLEEQGL   362
YKR066C_LalvinQA23   348   APSPFIFKTLEEQGL   362
YKR066C_PW5   347   APSPFIFKTLEEQGL   361
YKR066C_RM11-1a   348   APSPFIFKTLEEQGL   362
YKR066C_RedStar   349   APSPFIFKTLEEQGL   363
YKR066C_SEY6210   347   APSPFIFKTLEEQGL   361
YKR066C_SK1   347   APSPFIFKTLEEQGL   361
YKR066C_T7   347   APSPFIFKTLEEQGL   361
YKR066C_T73   347   APSPFIFKTLEE---   358
YKR066C_UC5   349   APSPFIFKTLEEQGL   363
YKR066C_VL3   162   APSPFIFKTLEEQGL   176
YKR066C_Vin13   348   APSPFIFKTLEEQGL   362
YKR066C_W303   347   APSPFIFKTLEEQGL   361
YKR066C_X2180-1A   347   APSPFIFKTLEEQGL   361
YKR066C_Y10   351   APSPFIFKTLEEQGL   365
YKR066C_Y55   347   APSPFIFKTLEEQGL   361
YKR066C_YJM269   351   APSPFIFKTLEEQGL   365
YKR066C_YJM339   348   APSPFIFKTLEEQGL   362
YKR066C_YJM789   348   APSPFIFKTLEEQGL   362
YKR066C_YPH499   347   APSPFIFKTLEEQGL   361
YKR066C_YPS128   347   APSPFIFKTLEEQGL   361
YKR066C_YPS163   347   APSPFIFKTLEEQGL   361
YKR066C_YS9   344   APSPFIFKTLEEQGL   358
YKR066C_ZTW1   349   APSPFIFKTLEEQGL   363
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YKR066C_S288C from SGD:

YKR066C_S288C [source=SGD]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_AWRI1631 from AWRI:

YKR066C_AWRI1631 [source=AWRI]  Length: 177  Wed Sep 20 20:40:22 2017  Type: P  Check: 5897  ..

       1  MQGPKIPWRC GRVDTPEDTT PDNGRLPDAD KDAGYVRTFF QRLNMNDREV

      51  VALMGAHALG KTHLKNSGYE GPWGAANNVF TNEFYLNLLN EDWKLEKNDA

     101  NNEQWDSKSG YMMLPTDYSL IQDPKYLSIV KEYANDQDKF FKDFSKAFEK

     151  LLENGITFPK DAPSPFIFKT LEEQGL*

Protein Sequence for YKR066C_AWRI796 from AWRI:

YKR066C_AWRI796 [source=AWRI]  Length: 177  Wed Sep 20 20:40:22 2017  Type: P  Check: 5897  ..

       1  MQGPKIPWRC GRVDTPEDTT PDNGRLPDAD KDAGYVRTFF QRLNMNDREV

      51  VALMGAHALG KTHLKNSGYE GPWGAANNVF TNEFYLNLLN EDWKLEKNDA

     101  NNEQWDSKSG YMMLPTDYSL IQDPKYLSIV KEYANDQDKF FKDFSKAFEK

     151  LLENGITFPK DAPSPFIFKT LEEQGL*

Protein Sequence for YKR066C_BC187 from Stanford:

YKR066C_BC187 [source=Stanford]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7567  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH TSGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_BY4741 from Stanford:

YKR066C_BY4741 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_BY4742 from Stanford:

YKR066C_BY4742 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_CBS7960 from WashU:

YKR066C_CBS7960 [source=WashU]  Length: 177  Wed Sep 20 20:40:22 2017  Type: P  Check: 5795  ..

       1  MQGPKIPWRC GRVDTPEDTT PDNGRLPDAD KDADYVRTFF QRLNMNDREV

      51  VALMGAHALG KTHLKNSGYE GPWGAANNVF TNEFYLNLLN EDWKLEKNDA

     101  NNEQWDSKSG YMMLPTDYSL IQDPKYLSIV KEYANDQDKF FKDFSKAFEK

     151  LLENGITFPK DAPSPFIFKT LEEQGL*

Protein Sequence for YKR066C_CEN.PK from Stanford:

YKR066C_CEN.PK [source=Stanford]  Length: 364  Wed Sep 20 20:40:22 2017  Type: P  Check: 8072  ..

       1  MTTAVRFLPS LGRTAHKRSL YLFSAAAAAA AAAAATFAYS QSHKRSSSSP

      51  GGGSNHGWNN WGKAAALAST TPLVHVASVE KGRSYEDFQK VYNAIALKLR

     101  EDDEYDNYIG YGPVLVRLAW HTSGTWDKHD NTGGSYGGTY RFKKEFNDPS

     151  NAGLQNGFKF LEPIHKEFPW ISSGDLFSLG GVTAVQEMQG PKIPWRCGRV

     201  DTPEDTTPDN GRLPDADKDA GYVRTFFQRL NMNDREVVAL MGAHALGKTH

     251  LKNSGYEGPW GAANNVFTNE FYLNLLNEDW KLEKNDANNE QWDSKSGYMM

     301  LPTDYSLIQD PKYLSIVKEY ANDQDKFFKD FSKAFEKLLE NGITFPKDAP

     351  SPFIFKTLEE QGL*

Protein Sequence for YKR066C_CLIB215 from WashU:

YKR066C_CLIB215 [source=WashU]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7567  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH TSGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_D273-10B from Stanford:

YKR066C_D273-10B [source=Stanford]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7490  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH ISGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_DBVPG6044 from Stanford:

YKR066C_DBVPG6044 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7112  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_EC1118 from Genoscope:

YKR066C_EC1118 [source=Genoscope]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7567  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH TSGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_EC9-8 from ASinica:

YKR066C_EC9-8 [source=ASinica]  Length: 359  Wed Sep 20 20:40:22 2017  Type: P  Check: 3215  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA TFAYSQSHKR SSSSPGGGSN

      51  HGWNNWGKAA ALASTTPLVH VASVEKGRSY EDFQKVYNAI ALKLREDDEY

     101  DNYIGYGPVL VRLAWHTSGT WDKHDNTGGS YGGTYRFKKE FNDPSNAGLQ

     151  NGFKFLEPIH KEFPWISSGD LFSLGGVTAV QEMQGPKIPW RCGRVDTPED

     201  TTPDNGRLPD ADKDADYVRT FFQRLNMNDR EVVALMGAHA LGKTHLKNSG

     251  YEGPWGAANN VFTNEFYLNL LNEDWKLEKN DANNEQWDSK SGYMMLPTDY

     301  SLIQDPKYLS IVKEYANDQD KFFKDFSKAF EKLLENGITF PKDAPSPFIF

     351  KTLEEQGL*

Protein Sequence for YKR066C_FL100 from Stanford:

YKR066C_FL100 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_FY1679 from Stanford:

YKR066C_FY1679 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_FostersB from AWRI:

YKR066C_FostersB [source=AWRI]  Length: 177  Wed Sep 20 20:40:22 2017  Type: P  Check: 6044  ..

       1  MQGPKIPWRC GRVDTPEDTT PDNGRLPDAD KDAGYVRTFF QRLNMNDREV

      51  VALMGAHALG KTHLKNSGYE GPWGAANNVF TNEFYLNLLN EDWKLEKNDA

     101  NNEQWGSKSG YMMLPTDYSL IQDPKYLSIV KEYANDQDKF FKDFSKAFEK

     151  LLENGITFPK DAPSPFIFKT LEEQGL*

Protein Sequence for YKR066C_FostersO from AWRI:

YKR066C_FostersO [source=AWRI]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7588  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH TSGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WGSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_JAY291 from Duke:

YKR066C_JAY291 [source=Duke]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7256  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDAGY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_JK9-3d from Stanford:

YKR066C_JK9-3d [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_K11 from Stanford:

YKR066C_K11 [source=Stanford]  Length: 364  Wed Sep 20 20:40:22 2017  Type: P  Check: 7964  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAAATFAYS QSHKRSSSSP

      51  GGGSNHGWNN WGKAAALAST TPLVHVASVE KGRSYEDFQK VYNAIALKLR

     101  EDDEYDNYIG YGPVLVRLAW HTSGTWDKHD NTGGSYGGTY RFKKEFNDPS

     151  NAGLQNGFKF LEPIHKEFPW ISSGDLFSLG GVTAVQEMQG PKIPWRCGRV

     201  DTPEDTTPDN GRLPDADKDA DYVRTFFQRL NMNDREVVAL MGAHALGKTH

     251  LKNSGYEGPW GAANNVFTNE FYLNLLNEDW KLEKNDANNE QWDSKSGYMM

     301  LPTDYSLIQD PKYLSIVKEY ANDQDKFFKD FSKAFEKLLE NGITFPKDAP

     351  SPFIFKTLEE QGL*

Protein Sequence for YKR066C_Kyokai7 from NRIB:

YKR066C_Kyokai7 [source=NRIB]  Length: 364  Wed Sep 20 20:40:22 2017  Type: P  Check: 7964  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAAATFAYS QSHKRSSSSP

      51  GGGSNHGWNN WGKAAALAST TPLVHVASVE KGRSYEDFQK VYNAIALKLR

     101  EDDEYDNYIG YGPVLVRLAW HTSGTWDKHD NTGGSYGGTY RFKKEFNDPS

     151  NAGLQNGFKF LEPIHKEFPW ISSGDLFSLG GVTAVQEMQG PKIPWRCGRV

     201  DTPEDTTPDN GRLPDADKDA DYVRTFFQRL NMNDREVVAL MGAHALGKTH

     251  LKNSGYEGPW GAANNVFTNE FYLNLLNEDW KLEKNDANNE QWDSKSGYMM

     301  LPTDYSLIQD PKYLSIVKEY ANDQDKFFKD FSKAFEKLLE NGITFPKDAP

     351  SPFIFKTLEE QGL*

Protein Sequence for YKR066C_L1528 from Stanford:

YKR066C_L1528 [source=Stanford]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7490  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH ISGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_LalvinQA23 from AWRI:

YKR066C_LalvinQA23 [source=AWRI]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 8131  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH TSGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLXNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_PW5 from WashU:

YKR066C_PW5 [source=WashU]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7112  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_RM11-1a from Stanford:

YKR066C_RM11-1a [source=Stanford]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7490  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH ISGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_RedStar from Stanford:

YKR066C_RedStar [source=Stanford]  Length: 364  Wed Sep 20 20:40:22 2017  Type: P  Check: 8072  ..

       1  MTTAVRFLPS LGRTAHKRSL YLFSAAAAAA AAAAATFAYS QSHKRSSSSP

      51  GGGSNHGWNN WGKAAALAST TPLVHVASVE KGRSYEDFQK VYNAIALKLR

     101  EDDEYDNYIG YGPVLVRLAW HTSGTWDKHD NTGGSYGGTY RFKKEFNDPS

     151  NAGLQNGFKF LEPIHKEFPW ISSGDLFSLG GVTAVQEMQG PKIPWRCGRV

     201  DTPEDTTPDN GRLPDADKDA GYVRTFFQRL NMNDREVVAL MGAHALGKTH

     251  LKNSGYEGPW GAANNVFTNE FYLNLLNEDW KLEKNDANNE QWDSKSGYMM

     301  LPTDYSLIQD PKYLSIVKEY ANDQDKFFKD FSKAFEKLLE NGITFPKDAP

     351  SPFIFKTLEE QGL*

Protein Sequence for YKR066C_SEY6210 from Stanford:

YKR066C_SEY6210 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_SK1 from Stanford:

YKR066C_SK1 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7112  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_T7 from WashU:

YKR066C_T7 [source=WashU]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7112  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_T73 from WashU:

YKR066C_T73 [source=WashU]  Length: 358  Wed Sep 20 20:40:22 2017  Type: P  Check: 1873  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHEEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEE

Protein Sequence for YKR066C_UC5 from WashU:

YKR066C_UC5 [source=WashU]  Length: 364  Wed Sep 20 20:40:22 2017  Type: P  Check: 8135  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAAATFAYS QSHKRSSSSP

      51  GGGSNHGWNN WGKAATLAST TPLVHVASVE KGRSYEDFQK VYNAIALKLR

     101  EDDEYDNYIG YGPVLVRLAW HTSGTWDKHD NTGGSYGGTY RFKKEFNDPS

     151  NAGLQNGFKF LEPIHKEFPW ISSGDLFSLG GVTAVQEMQG PKIPWRCGRV

     201  DTPEDTTPDN GRLPDADKDA DYVRTFFQRL NMNDREVVAL MGAHALGKTH

     251  LKNSGYEGPW GAANNVFTNE FYLNLLNEDW KLEKNDANNE QWDSKSGYMM

     301  LPTDYSLIQD PKYLSIVKEY ANDQDKFFKD FSKAFEKLLE NGITFPKDAP

     351  SPFIFKTLEE QGL*

Protein Sequence for YKR066C_VL3 from AWRI:

YKR066C_VL3 [source=AWRI]  Length: 177  Wed Sep 20 20:40:22 2017  Type: P  Check: 5999  ..

       1  MQGPKIPWRC GRVDTPEDTT PDNGRLPDAD KDAGYVRTFF QRLNMNDREV

      51  XALMGAHALG KTHLKNSGYE GPWGAANNVF TNEFYLNLLN EDWKLEKNDA

     101  NNEQWDSKSG YMMLPTDYSL IQDPKYLSIV KEYANDQDKF FKDFSKAFEK

     151  LLENGITFPK DAPSPFIFKT LEEQGL*

Protein Sequence for YKR066C_Vin13 from AWRI:

YKR066C_Vin13 [source=AWRI]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7643  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLTWH TSGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_W303 from Stanford:

YKR066C_W303 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7112  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_X2180-1A from Stanford:

YKR066C_X2180-1A [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_Y10 from WashU:

YKR066C_Y10 [source=WashU]  Length: 366  Wed Sep 20 20:40:22 2017  Type: P  Check: 159  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAAAAATFA YSQSHKRSSS

      51  SPGGGSNHGW NNWGKAAALA STTPLVHVAS VEKGRSYEDF QKVYNAIALK

     101  LREDDEYDNY IGYGPVLVRL AWHTSGTWDK HDNTGGSYGG TYRFKKEFND

     151  PSNAGLQNGF KFLEPIHKEF PWISSGDLFS LGGVTAVQEM QGPKIPWRCG

     201  RVDTPEDTTP DNGRLPDADK DADYVRTFFQ RLNMNDREVV ALMGAHALGK

     251  THLKNSGYEG PWGAANNVFT NEFYLNLLNE DWKLEKNDAN NEQWDSKSGY

     301  MMLPTDYSLI QDPKYLSIVK EYANDQDKFF KDFSKAFEKL LENGITFPKD

     351  APSPFIFKTL EEQGL*

Protein Sequence for YKR066C_Y55 from Stanford:

YKR066C_Y55 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7112  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_YJM269 from WashU:

YKR066C_YJM269 [source=WashU]  Length: 366  Wed Sep 20 20:40:22 2017  Type: P  Check: 159  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAAAAATFA YSQSHKRSSS

      51  SPGGGSNHGW NNWGKAAALA STTPLVHVAS VEKGRSYEDF QKVYNAIALK

     101  LREDDEYDNY IGYGPVLVRL AWHTSGTWDK HDNTGGSYGG TYRFKKEFND

     151  PSNAGLQNGF KFLEPIHKEF PWISSGDLFS LGGVTAVQEM QGPKIPWRCG

     201  RVDTPEDTTP DNGRLPDADK DADYVRTFFQ RLNMNDREVV ALMGAHALGK

     251  THLKNSGYEG PWGAANNVFT NEFYLNLLNE DWKLEKNDAN NEQWDSKSGY

     301  MMLPTDYSLI QDPKYLSIVK EYANDQDKFF KDFSKAFEKL LENGITFPKD

     351  APSPFIFKTL EEQGL*

Protein Sequence for YKR066C_YJM339 from Stanford:

YKR066C_YJM339 [source=Stanford]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7567  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH TSGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_YJM789 from Stanford:

YKR066C_YJM789 [source=Stanford]  Length: 363  Wed Sep 20 20:40:22 2017  Type: P  Check: 7567  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAATFAYSQ SHKRSSSSPG

      51  GGSNHGWNNW GKAAALASTT PLVHVASVEK GRSYEDFQKV YNAIALKLRE

     101  DDEYDNYIGY GPVLVRLAWH TSGTWDKHDN TGGSYGGTYR FKKEFNDPSN

     151  AGLQNGFKFL EPIHKEFPWI SSGDLFSLGG VTAVQEMQGP KIPWRCGRVD

     201  TPEDTTPDNG RLPDADKDAG YVRTFFQRLN MNDREVVALM GAHALGKTHL

     251  KNSGYEGPWG AANNVFTNEF YLNLLNEDWK LEKNDANNEQ WDSKSGYMML

     301  PTDYSLIQDP KYLSIVKEYA NDQDKFFKDF SKAFEKLLEN GITFPKDAPS

     351  PFIFKTLEEQ GL*

Protein Sequence for YKR066C_YPH499 from Stanford:

YKR066C_YPH499 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7481  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS QKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_YPS128 from Stanford:

YKR066C_YPS128 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7112  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_YPS163 from Stanford:

YKR066C_YPS163 [source=Stanford]  Length: 362  Wed Sep 20 20:40:22 2017  Type: P  Check: 7112  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAATFAYSQS HKRSSSSPGG

      51  GSNHGWNNWG KAAALASTTP LVHVASVEKG RSYEDFQKVY NAIALKLRED

     101  DEYDNYIGYG PVLVRLAWHT SGTWDKHDNT GGSYGGTYRF KKEFNDPSNA

     151  GLQNGFKFLE PIHKEFPWIS SGDLFSLGGV TAVQEMQGPK IPWRCGRVDT

     201  PEDTTPDNGR LPDADKDADY VRTFFQRLNM NDREVVALMG AHALGKTHLK

     251  NSGYEGPWGA ANNVFTNEFY LNLLNEDWKL EKNDANNEQW DSKSGYMMLP

     301  TDYSLIQDPK YLSIVKEYAN DQDKFFKDFS KAFEKLLENG ITFPKDAPSP

     351  FIFKTLEEQG L*

Protein Sequence for YKR066C_YS9 from Stanford:

YKR066C_YS9 [source=Stanford]  Length: 359  Wed Sep 20 20:40:22 2017  Type: P  Check: 3215  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA TFAYSQSHKR SSSSPGGGSN

      51  HGWNNWGKAA ALASTTPLVH VASVEKGRSY EDFQKVYNAI ALKLREDDEY

     101  DNYIGYGPVL VRLAWHTSGT WDKHDNTGGS YGGTYRFKKE FNDPSNAGLQ

     151  NGFKFLEPIH KEFPWISSGD LFSLGGVTAV QEMQGPKIPW RCGRVDTPED

     201  TTPDNGRLPD ADKDADYVRT FFQRLNMNDR EVVALMGAHA LGKTHLKNSG

     251  YEGPWGAANN VFTNEFYLNL LNEDWKLEKN DANNEQWDSK SGYMMLPTDY

     301  SLIQDPKYLS IVKEYANDQD KFFKDFSKAF EKLLENGITF PKDAPSPFIF

     351  KTLEEQGL*

Protein Sequence for YKR066C_ZTW1 from Zhejiang:

YKR066C_ZTW1 [source=Zhejiang]  Length: 364  Wed Sep 20 20:40:22 2017  Type: P  Check: 8135  ..

       1  MTTAVRLLPS LGRTAHKRSL YLFSAAAAAA AAAAATFAYS QSHKRSSSSP

      51  GGGSNHGWNN WGKAATLAST TPLVHVASVE KGRSYEDFQK VYNAIALKLR

     101  EDDEYDNYIG YGPVLVRLAW HTSGTWDKHD NTGGSYGGTY RFKKEFNDPS

     151  NAGLQNGFKF LEPIHKEFPW ISSGDLFSLG GVTAVQEMQG PKIPWRCGRV

     201  DTPEDTTPDN GRLPDADKDA DYVRTFFQRL NMNDREVVAL MGAHALGKTH

     251  LKNSGYEGPW GAANNVFTNE FYLNLLNEDW KLEKNDANNE QWDSKSGYMM

     301  LPTDYSLIQD PKYLSIVKEY ANDQDKFFKD FSKAFEKLLE NGITFPKDAP

     351  SPFIFKTLEE QGL*