KTI12/YKL110C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YKL110C_S288C   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_AWRI1631   1   MPLLLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_AWRI796   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_BC187   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_BY4741   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_BY4742   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_CBS7960   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_CEN.PK   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_CLIB215   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_CLIB324   1   MPLVLFTGYPCSGNTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_CLIB382   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_D273-10B   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_DBVPG6044   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_EC1118   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_EC9-8   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_FL100   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_FY1679   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_FostersB   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_FostersO   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_JAY291   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_JK9-3d   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_K11   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_Kyokai7   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_L1528   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_LalvinQA23   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_PW5   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_RM11-1a   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_RedStar   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_SEY6210   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_SK1   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_T7   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_T73   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_UC5   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_UWOPS05_217_3   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSLIYHSDESLGI   50
YKL110C_VL3   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_Vin13   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_W303   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_X2180-1A   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_Y55   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_YJM269   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_YJM339   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_YJM789   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_YPH499   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_YPS128   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_YPS163   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_YS9   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
YKL110C_ZTW1   1   MPLVLFTGYPCSGKTTLAKHLVQLLQSKIDATPSLSKYSITYHSDESLGI   50
         

YKL110C_S288C   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_AWRI1631   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_AWRI796   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_BC187   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_BY4741   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_BY4742   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_CBS7960   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_CEN.PK   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_CLIB215   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_CLIB324   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_CLIB382   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_D273-10B   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_DBVPG6044   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_EC1118   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_EC9-8   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_FL100   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_FY1679   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_FostersB   51   KHSDYITSQDERKLRSEIIXAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_FostersO   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_JAY291   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_JK9-3d   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_K11   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_Kyokai7   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_L1528   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_LalvinQA23   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_PW5   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_RM11-1a   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_RedStar   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_SEY6210   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_SK1   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_T7   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_T73   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_UC5   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_UWOPS05_217_3   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_VL3   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_Vin13   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_W303   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_X2180-1A   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_Y55   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_YJM269   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_YJM339   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_YJM789   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_YPH499   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_YPS128   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_YPS163   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_YS9   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
YKL110C_ZTW1   51   KHSDYITSQDERKLRSEIISAVKRDLSKNKIVIVDSLNYIKGFRYQLHCE   100
         

YKL110C_S288C   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_AWRI1631   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_AWRI796   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_BC187   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_BY4741   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_BY4742   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_CBS7960   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_CEN.PK   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_CLIB215   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_CLIB324   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_CLIB382   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_D273-10B   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_DBVPG6044   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_EC1118   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_EC9-8   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_FL100   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_FY1679   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_FostersB   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_FostersO   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_JAY291   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_JK9-3d   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_K11   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_Kyokai7   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_L1528   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_LalvinQA23   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_PW5   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_RM11-1a   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_RedStar   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_SEY6210   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_SK1   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_T7   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_T73   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_UC5   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_UWOPS05_217_3   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_VL3   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPRVIESIDSTIRRA---   147
YKL110C_Vin13   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_W303   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_X2180-1A   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_Y55   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_YJM269   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_YJM339   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_YJM789   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_YPH499   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSS   150
YKL110C_YPS128   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_YPS163   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_YS9   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
YKL110C_ZTW1   101   VKNLSTTFCVIQTLCPPETIFEWNKTSNPNPWEPELLNQLIQRYEEPNSN   150
         

YKL110C_S288C   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_AWRI1631   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_AWRI796   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_BC187   151   NRWDSPLFDILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_BY4741   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_BY4742   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_CBS7960   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_CEN.PK   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_CLIB215   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_CLIB324   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_CLIB382   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_D273-10B   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_DBVPG6044   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_EC1118   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_EC9-8   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_FL100   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_FY1679   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_FostersB   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_FostersO   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_JAY291   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_JK9-3d   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_K11   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_Kyokai7   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_L1528   151   NRWDSPLFDILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_LalvinQA23   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_PW5   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_RM11-1a   151   NRWDSPLFDILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_RedStar   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_SEY6210   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_SK1   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_T7   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_T73   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_UC5   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_UWOPS05_217_3   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_VL3   
   --------------------------------------------------   
YKL110C_Vin13   151   NRWDSPLFXILTPQDNITDYIDDICKVSLSNFQIG---------------   185
YKL110C_W303   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_X2180-1A   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_Y55   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_YJM269   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_YJM339   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_YJM789   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_YPH499   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_YPS128   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_YPS163   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_YS9   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
YKL110C_ZTW1   151   NRWDSPLFAILTPQDNITDYIDDICKVVFQTSKSAKNSGHNDPLSKGLQK   200
         

YKL110C_S288C   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_AWRI1631   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_AWRI796   201   PNSATVLKPASQSNFIQVLDIETSKIXKNHNEPHQKPDFYWRGK------   244
YKL110C_BC187   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_BY4741   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_BY4742   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_CBS7960   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_CEN.PK   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_CLIB215   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_CLIB324   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_CLIB382   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_D273-10B   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_DBVPG6044   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_EC1118   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_EC9-8   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_FL100   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_FY1679   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_FostersB   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_FostersO   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_JAY291   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_JK9-3d   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_K11   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_Kyokai7   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_L1528   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_LalvinQA23   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_PW5   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_RM11-1a   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_RedStar   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_SEY6210   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_SK1   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_T7   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_T73   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_UC5   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_UWOPS05_217_3   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_VL3   
   --------------------------------------------------   
YKL110C_Vin13   
   --------------------------------------------------   
YKL110C_W303   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_X2180-1A   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_Y55   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_YJM269   201   PNSATVLKPASQSNFIQVLDIETSKIIKTMMNHIKSLTSIGGVSNGTRVI   250
YKL110C_YJM339   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_YJM789   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_YPH499   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_YPS128   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_YPS163   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_YS9   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
YKL110C_ZTW1   201   PNSATVLKPASQSNFIQVLDIETSKIIKTIMNHIKSLTSIGGVSNGTRVI   250
         

YKL110C_S288C   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_AWRI1631   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_AWRI796   
   --------------------------------------------------   
YKL110C_BC187   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_BY4741   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_BY4742   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_CBS7960   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_CEN.PK   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_CLIB215   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_CLIB324   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_CLIB382   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_D273-10B   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_DBVPG6044   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_EC1118   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_EC9-8   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_FL100   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_FY1679   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_FostersB   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_FostersO   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_JAY291   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_JK9-3d   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_K11   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_Kyokai7   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_L1528   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_LalvinQA23   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_PW5   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_RM11-1a   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_RedStar   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_SEY6210   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_SK1   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_T7   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_T73   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_UC5   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_UWOPS05_217_3   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_VL3   
   --------------------------------------------------   
YKL110C_Vin13   
   --------------------------------------------------   
YKL110C_W303   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_X2180-1A   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_Y55   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_YJM269   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQIH-------------   287
YKL110C_YJM339   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_YJM789   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_YPH499   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_YPS128   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_YPS163   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_YS9   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
YKL110C_ZTW1   251   VSEGITDINDDGCFFVDLPIGNVVTLAQLQRLKRQFINFNKLRDIDQDRI   300
         

YKL110C_S288C   301   GPLFADYLNKNLN   313
YKL110C_AWRI1631   301   GPLFADYLNKNLN   313
YKL110C_AWRI796   
   -------------   
YKL110C_BC187   301   GPLFADYLNKNLN   313
YKL110C_BY4741   301   GPLFADYLNKNLN   313
YKL110C_BY4742   301   GPLFADYLNKNLN   313
YKL110C_CBS7960   301   GPLFADYLNKNLN   313
YKL110C_CEN.PK   301   GPLFADYLNKNLN   313
YKL110C_CLIB215   301   GPLFADYLNKNLN   313
YKL110C_CLIB324   301   GPLFADYLNKNLN   313
YKL110C_CLIB382   301   GPLFADYLNKNLN   313
YKL110C_D273-10B   301   GPLFADYLNKNLN   313
YKL110C_DBVPG6044   301   GPLFADYLNKNLN   313
YKL110C_EC1118   301   GPLFADYLNKNLN   313
YKL110C_EC9-8   301   GPLFADYLNKNLN   313
YKL110C_FL100   301   GPLFADYLNKNLN   313
YKL110C_FY1679   301   GPLFADYLNKNLN   313
YKL110C_FostersB   301   GPLFADYLNKNLN   313
YKL110C_FostersO   301   GPLFADYLNKNLN   313
YKL110C_JAY291   301   GPLFADYLNKNLN   313
YKL110C_JK9-3d   301   GPLFADYLNKNLN   313
YKL110C_K11   301   GPLFADYLNKNLN   313
YKL110C_Kyokai7   301   GPLFADYLNKNLN   313
YKL110C_L1528   301   GPLFADYLNKNLN   313
YKL110C_LalvinQA23   301   GPLFADYLNKNLN   313
YKL110C_PW5   301   GPLFADYLNKNLN   313
YKL110C_RM11-1a   301   GPLFADYLNKNLN   313
YKL110C_RedStar   301   GPLFADYLNKNLN   313
YKL110C_SEY6210   301   GPLFADYLNKNLN   313
YKL110C_SK1   301   GPLFADYLNKNLN   313
YKL110C_T7   301   GPLFADYLNKNLN   313
YKL110C_T73   301   GPLFADYLNKNLN   313
YKL110C_UC5   301   GPLFADYLNKNLN   313
YKL110C_UWOPS05_217_3   301   GPLFADYLNKNLN   313
YKL110C_VL3   
   -------------   
YKL110C_Vin13   
   -------------   
YKL110C_W303   301   GPLFADYLNKNLN   313
YKL110C_X2180-1A   301   GPLFADYLNKNLN   313
YKL110C_Y55   301   GPLFADYLNKNLN   313
YKL110C_YJM269   
   -------------   
YKL110C_YJM339   301   GPLFADYLNKNLN   313
YKL110C_YJM789   301   GPLFADYLNKNLN   313
YKL110C_YPH499   301   GPLFADYLNKNLN   313
YKL110C_YPS128   301   GPLFADYLNKNLN   313
YKL110C_YPS163   301   GPLFADYLNKNLN   313
YKL110C_YS9   301   GPLFADYLNKNLN   313
YKL110C_ZTW1   301   GPLFADYLNKNLN   313
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YKL110C_S288C from SGD:

YKL110C_S288C [source=SGD]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_AWRI1631 from AWRI:

YKL110C_AWRI1631 [source=AWRI]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9351  ..

       1  MPLLLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_AWRI796 from AWRI:

YKL110C_AWRI796 [source=AWRI]  Length: 245  Sun Sep 24 01:50:18 2017  Type: P  Check: 2741  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIXKNH NEPHQKPDFY WRGK*


Protein Sequence for YKL110C_BC187 from Stanford:

YKL110C_BC187 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9526  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFDI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_BY4741 from Stanford:

YKL110C_BY4741 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_BY4742 from Stanford:

YKL110C_BY4742 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_CBS7960 from WashU:

YKL110C_CBS7960 [source=WashU]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_CEN.PK from Stanford:

YKL110C_CEN.PK [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_CLIB215 from WashU:

YKL110C_CLIB215 [source=WashU]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_CLIB324 from WashU:

YKL110C_CLIB324 [source=WashU]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9613  ..

       1  MPLVLFTGYP CSGNTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_CLIB382 from WashU:

YKL110C_CLIB382 [source=WashU]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_D273-10B from Stanford:

YKL110C_D273-10B [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_DBVPG6044 from Stanford:

YKL110C_DBVPG6044 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_EC1118 from Genoscope:

YKL110C_EC1118 [source=Genoscope]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_EC9-8 from ASinica:

YKL110C_EC9-8 [source=ASinica]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_FL100 from Stanford:

YKL110C_FL100 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_FY1679 from Stanford:

YKL110C_FY1679 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_FostersB from AWRI:

YKL110C_FostersB [source=AWRI]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9456  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIX AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_FostersO from AWRI:

YKL110C_FostersO [source=AWRI]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_JAY291 from Duke:

YKL110C_JAY291 [source=Duke]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_JK9-3d from Stanford:

YKL110C_JK9-3d [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_K11 from Stanford:

YKL110C_K11 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_Kyokai7 from NRIB:

YKL110C_Kyokai7 [source=NRIB]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_L1528 from Stanford:

YKL110C_L1528 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9526  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFDI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_LalvinQA23 from AWRI:

YKL110C_LalvinQA23 [source=AWRI]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_PW5 from WashU:

YKL110C_PW5 [source=WashU]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_RM11-1a from Stanford:

YKL110C_RM11-1a [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9526  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFDI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_RedStar from Stanford:

YKL110C_RedStar [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_SEY6210 from Stanford:

YKL110C_SEY6210 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_SK1 from Stanford:

YKL110C_SK1 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_T7 from WashU:

YKL110C_T7 [source=WashU]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_T73 from WashU:

YKL110C_T73 [source=WashU]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_UC5 from WashU:

YKL110C_UC5 [source=WashU]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_UWOPS05_217_3 from Stanford:

YKL110C_UWOPS05_217_3 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9060  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSL IYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_VL3 from AWRI:

YKL110C_VL3 [source=AWRI]  Length: 148  Sun Sep 24 01:50:18 2017  Type: P  Check: 1065  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPRVIESI DSTIRRA*


Protein Sequence for YKL110C_Vin13 from AWRI:

YKL110C_Vin13 [source=AWRI]  Length: 186  Sun Sep 24 01:50:18 2017  Type: P  Check: 3544  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFXI LTPQDNITDY IDDICKVSLS NFQIG*

Protein Sequence for YKL110C_W303 from Stanford:

YKL110C_W303 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_X2180-1A from Stanford:

YKL110C_X2180-1A [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_Y55 from Stanford:

YKL110C_Y55 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_YJM269 from WashU:

YKL110C_YJM269 [source=WashU]  Length: 288  Sun Sep 24 01:50:18 2017  Type: P  Check: 7938  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTM MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQIH*

Protein Sequence for YKL110C_YJM339 from Stanford:

YKL110C_YJM339 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_YJM789 from Stanford:

YKL110C_YJM789 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_YPH499 from Stanford:

YKL110C_YPH499 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9571  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSS

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_YPS128 from Stanford:

YKL110C_YPS128 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_YPS163 from Stanford:

YKL110C_YPS163 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_YS9 from Stanford:

YKL110C_YS9 [source=Stanford]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*

Protein Sequence for YKL110C_ZTW1 from Zhejiang:

YKL110C_ZTW1 [source=Zhejiang]  Length: 314  Sun Sep 24 01:50:18 2017  Type: P  Check: 9391  ..

       1  MPLVLFTGYP CSGKTTLAKH LVQLLQSKID ATPSLSKYSI TYHSDESLGI

      51  KHSDYITSQD ERKLRSEIIS AVKRDLSKNK IVIVDSLNYI KGFRYQLHCE

     101  VKNLSTTFCV IQTLCPPETI FEWNKTSNPN PWEPELLNQL IQRYEEPNSN

     151  NRWDSPLFAI LTPQDNITDY IDDICKVVFQ TSKSAKNSGH NDPLSKGLQK

     201  PNSATVLKPA SQSNFIQVLD IETSKIIKTI MNHIKSLTSI GGVSNGTRVI

     251  VSEGITDIND DGCFFVDLPI GNVVTLAQLQ RLKRQFINFN KLRDIDQDRI

     301  GPLFADYLNK NLN*