YKL036C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YKL036C_S288C   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_AWRI1631   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_AWRI796   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_CBS7960   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_CLIB324   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_CLIB382   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_EC1118   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_EC9-8   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIKSPTPKTV   50
YKL036C_FostersB   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_FostersO   1   MCFGVLLSGHYYVMXHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_JAY291   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_Kyokai7   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_LalvinQA23   1   MCFGVLLSGHYYVMXHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_M22   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_PW5   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_T7   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_UC5   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_VL3   1   MCFGVLLSGHYYVMXHLLWKLYYIIGRGLGLLTLLMWKRTRN--------   42
YKL036C_Vin13   1   MCFGVLLSGHYYVMXHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_YJM269   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_YJM789   1   MCFGVLLSGHYYVMVHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
YKL036C_ZTW1   1   MCFGVLLSGHYYVMIHLLWKLYYIIGRGLGLLTLLMWKEPEIESPTPKTV   50
         

YKL036C_S288C   51   TSISWYLLEELCCLFRFIYSIQNRERKCKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_AWRI1631   51   TSISWYLLEELCCLFRFIYSIQNRERKCKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_AWRI796   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_CBS7960   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_CLIB324   51   TSISWYLLEELCCLFRFIYSIQNRERKCKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_CLIB382   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_EC1118   51   TSISWYLLEELCCLFRFIYSIQNRERNSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_EC9-8   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_FostersB   51   TSISWYLLEELCCLFRFIYSIQNRERKXKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_FostersO   51   TSISWYLLEELCCLFRFIYSIQNRERKCKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_JAY291   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_Kyokai7   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_LalvinQA23   51   TSISWYLLEELCCLFRFIYSIQNRERKXKNGPSPNKRGSASGCSRRGGGK   100
YKL036C_M22   51   TSISWYLLEELCCLFRFIYSIQNRERKCKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_PW5   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_T7   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_UC5   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_VL3   
   --------------------------------------------------   
YKL036C_Vin13   51   TSISWYLLEELCCLFRFIYSIQNRERKXKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_YJM269   51   TSISWYLLEELCCLFRFIYSIQNRERKCKNGPSP-TKEEARQAVREGAGE   99
YKL036C_YJM789   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
YKL036C_ZTW1   51   TSISWYLLEELCCLFRFIYSIQNRERKSKNGPSPNKRGSASGCSRRGGGR   100
         

YKL036C_S288C   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_AWRI1631   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_AWRI796   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_CBS7960   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_CLIB324   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_CLIB382   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_EC1118   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_EC9-8   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_FostersB   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_FostersO   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_JAY291   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_Kyokai7   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_LalvinQA23   101   GIRLQDAVQGSV------------------   112
YKL036C_M22   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_PW5   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_T7   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_UC5   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_VL3   
   ------------------------------   
YKL036C_Vin13   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_YJM269   100   GDQVTRRCTGICVRTNRHQNFGLCKRRN--   127
YKL036C_YJM789   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
YKL036C_ZTW1   101   GSGYKTLYRDLCENKPTPELWTLQAPELNL   130
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YKL036C_S288C from SGD:

YKL036C_S288C [source=SGD]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8173  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKCKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_AWRI1631 from AWRI:

YKL036C_AWRI1631 [source=AWRI]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8173  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKCKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_AWRI796 from AWRI:

YKL036C_AWRI796 [source=AWRI]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8314  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_CBS7960 from WashU:

YKL036C_CBS7960 [source=WashU]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8509  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_CLIB324 from WashU:

YKL036C_CLIB324 [source=WashU]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8173  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKCKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_CLIB382 from WashU:

YKL036C_CLIB382 [source=WashU]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8314  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_EC1118 from Genoscope:

YKL036C_EC1118 [source=Genoscope]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8569  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERNSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_EC9-8 from ASinica:

YKL036C_EC9-8 [source=ASinica]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8572  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIKSPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_FostersB from AWRI:

YKL036C_FostersB [source=AWRI]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8419  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKXKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_FostersO from AWRI:

YKL036C_FostersO [source=AWRI]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8203  ..

       1  MCFGVLLSGH YYVMXHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKCKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_JAY291 from Duke:

YKL036C_JAY291 [source=Duke]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8509  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_Kyokai7 from NRIB:

YKL036C_Kyokai7 [source=NRIB]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8314  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_LalvinQA23 from AWRI:

YKL036C_LalvinQA23 [source=AWRI]  Length: 113  Mon Dec 11 09:12:54 2017  Type: P  Check: 1042  ..

       1  MCFGVLLSGH YYVMXHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKXKN GPSPNKRGSA SGCSRRGGGK

     101  GIRLQDAVQG SV*

Protein Sequence for YKL036C_M22 from WashU:

YKL036C_M22 [source=WashU]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8173  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKCKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_PW5 from WashU:

YKL036C_PW5 [source=WashU]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8314  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_T7 from WashU:

YKL036C_T7 [source=WashU]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8314  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_UC5 from WashU:

YKL036C_UC5 [source=WashU]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8314  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_VL3 from AWRI:

YKL036C_VL3 [source=AWRI]  Length: 43  Mon Dec 11 09:12:54 2017  Type: P  Check: 2881  ..

       1  MCFGVLLSGH YYVMXHLLWK LYYIIGRGLG LLTLLMWKRT RN*


Protein Sequence for YKL036C_Vin13 from AWRI:

YKL036C_Vin13 [source=AWRI]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8644  ..

       1  MCFGVLLSGH YYVMXHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKXKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_YJM269 from WashU:

YKL036C_YJM269 [source=WashU]  Length: 128  Mon Dec 11 09:12:54 2017  Type: P  Check: 4030  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKCKN GPSPTKEEAR QAVREGAGEG

     101  DQVTRRCTGI CVRTNRHQNF GLCKRRN*

Protein Sequence for YKL036C_YJM789 from Stanford:

YKL036C_YJM789 [source=Stanford]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8509  ..

       1  MCFGVLLSGH YYVMVHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *

Protein Sequence for YKL036C_ZTW1 from Zhejiang:

YKL036C_ZTW1 [source=Zhejiang]  Length: 131  Mon Dec 11 09:12:54 2017  Type: P  Check: 8314  ..

       1  MCFGVLLSGH YYVMIHLLWK LYYIIGRGLG LLTLLMWKEP EIESPTPKTV

      51  TSISWYLLEE LCCLFRFIYS IQNRERKSKN GPSPNKRGSA SGCSRRGGGR

     101  GSGYKTLYRD LCENKPTPEL WTLQAPELNL *