BAT2/YJR148W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YJR148W_S288C   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWG   50
YJR148W_AWRI1631   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_AWRI796   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_BC187   1   MTLAPLDASKVKITTTRHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_CBS7960   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_CEN.PK   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWG   50
YJR148W_CLIB215   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_CLIB324   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_EC1118   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_EC9-8   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWG   50
YJR148W_FY1679   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWG   50
YJR148W_FostersB   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_FostersO   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_JAY291   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_JK9-3d   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWG   50
YJR148W_K11   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_Kyokai7   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_L1528   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_LalvinQA23   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_PW5   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_RM11-1a   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_RedStar   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_SEY6210   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWG   50
YJR148W_T7   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_T73   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_UC5   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_UWOPS05_217_3   1   MTLTPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_VL3   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFXDHMLTXEWTAEKGWG   50
YJR148W_Vin13   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_W303   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWG   50
YJR148W_X2180-1A   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTAEWTAEKGWG   50
YJR148W_Y10   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_Y55   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_YJM269   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_YJM339   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_YJM789   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_YPS128   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_YPS163   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_YS9   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
YJR148W_ZTW1   1   MTLAPLDASKVKITTTQHASKPKPNSELVFGKSFTDHMLTVEWTAEKGWG   50
         

YJR148W_S288C   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_AWRI1631   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_AWRI796   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_BC187   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_CBS7960   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_CEN.PK   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_CLIB215   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_CLIB324   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_EC1118   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_EC9-8   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_FY1679   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_FostersB   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_FostersO   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_JAY291   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_JK9-3d   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_K11   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_Kyokai7   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_L1528   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_LalvinQA23   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_PW5   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_RM11-1a   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_RedStar   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_SEY6210   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_T7   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_T73   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_UC5   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_UWOPS05_217_3   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_VL3   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_Vin13   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_W303   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_X2180-1A   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_Y10   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_Y55   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_YJM269   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_YJM339   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_YJM789   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_YPS128   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_YPS163   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_YS9   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
YJR148W_ZTW1   51   TPEIKPYQNLSLDPSAVVFHYAFELFEGMKAYRTVDNKITMFRPDMNMKR   100
         

YJR148W_S288C   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT   150
YJR148W_AWRI1631   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_AWRI796   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_BC187   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_CBS7960   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_CEN.PK   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT   150
YJR148W_CLIB215   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_CLIB324   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT   150
YJR148W_EC1118   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_EC9-8   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_FY1679   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT   150
YJR148W_FostersB   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_FostersO   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_JAY291   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_JK9-3d   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT   150
YJR148W_K11   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_Kyokai7   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_L1528   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_LalvinQA23   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_PW5   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_RM11-1a   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_RedStar   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_SEY6210   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT   150
YJR148W_T7   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_T73   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_UC5   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_UWOPS05_217_3   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_VL3   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_Vin13   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_W303   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT   150
YJR148W_X2180-1A   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKCLVPEGKGYSLYIRPTLIGT   150
YJR148W_Y10   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_Y55   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_YJM269   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_YJM339   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_YJM789   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_YPS128   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_YPS163   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_YS9   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
YJR148W_ZTW1   101   MNKSAQRICLPTFDPEELITLIGKLIQQDKYLVPEGKGYSLYIRPTLIGT   150
         

YJR148W_S288C   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_AWRI1631   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_AWRI796   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_BC187   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_CBS7960   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_CEN.PK   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_CLIB215   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_CLIB324   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_EC1118   151   TAGLGVSTPDRALLYVICSPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_EC9-8   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_FY1679   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_FostersB   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_FostersO   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_JAY291   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_JK9-3d   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_K11   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_Kyokai7   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_L1528   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_LalvinQA23   151   TAGLGVSTPDRALLYVICXPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_PW5   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_RM11-1a   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_RedStar   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_SEY6210   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_T7   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_T73   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_UC5   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_UWOPS05_217_3   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_VL3   151   TXGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_Vin13   151   TAGFRGFHA-----------------------------------------   159
YJR148W_W303   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_X2180-1A   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_Y10   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_Y55   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_YJM269   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_YJM339   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_YJM789   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_YPS128   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_YPS163   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_YS9   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
YJR148W_ZTW1   151   TAGLGVSTPDRALLYVICCPVGPYYKTGFKAVRLEATDYATRAWPGGCGD   200
         

YJR148W_S288C   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_AWRI1631   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_AWRI796   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_BC187   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_CBS7960   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_CEN.PK   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_CLIB215   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_CLIB324   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_EC1118   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_EC9-8   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_FY1679   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_FostersB   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_FostersO   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_JAY291   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_JK9-3d   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_K11   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_Kyokai7   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_L1528   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_LalvinQA23   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_PW5   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_RM11-1a   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_RedStar   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_SEY6210   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_T7   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_T73   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_UC5   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_UWOPS05_217_3   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_VL3   201   KKLGANYXPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_Vin13   
   --------------------------------------------------   
YJR148W_W303   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_X2180-1A   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_Y10   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_Y55   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_YJM269   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_YJM339   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_YJM789   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_YPS128   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_YPS163   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_YS9   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
YJR148W_ZTW1   201   KKLGANYAPCVLPQLQAASRGYQQNLWLFGPNNNITEVGTMNAFFVFKDS   250
         

YJR148W_S288C   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_AWRI1631   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_AWRI796   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_BC187   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_CBS7960   251   KTGKKELVTAPLDGTILEGVTRDSIINLAKERLEPSEWTISERYFTIGEV   300
YJR148W_CEN.PK   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_CLIB215   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_CLIB324   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_EC1118   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_EC9-8   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_FY1679   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_FostersB   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWXISERYFTIGEV   300
YJR148W_FostersO   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWSISERYFTIGEV   300
YJR148W_JAY291   251   KTGKKELVTAPLDGTILEGVTRDSIINLAKERLEPSEWTISERYFTIGEV   300
YJR148W_JK9-3d   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_K11   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWSISERYFTIGEV   300
YJR148W_Kyokai7   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWSISERYFTIGEV   300
YJR148W_L1528   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_LalvinQA23   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_PW5   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_RM11-1a   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_RedStar   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWSISERYFTIGEV   300
YJR148W_SEY6210   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_T7   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_T73   251   KTGKKELVTAPLDGTILEGVTRDSIINLAKERLEPSEWTISERYFTIGEV   300
YJR148W_UC5   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_UWOPS05_217_3   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_VL3   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_Vin13   
   --------------------------------------------------   
YJR148W_W303   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_X2180-1A   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_Y10   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_Y55   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_YJM269   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_YJM339   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_YJM789   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_YPS128   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_YPS163   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
YJR148W_YS9   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWSISERYFTIGEV   300
YJR148W_ZTW1   251   KTGKKELVTAPLDGTILEGVTRDSILNLAKERLEPSEWTISERYFTIGEV   300
         

YJR148W_S288C   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_AWRI1631   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_AWRI796   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_BC187   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_CBS7960   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_CEN.PK   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_CLIB215   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_CLIB324   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_EC1118   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_EC9-8   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_FY1679   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_FostersB   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_FostersO   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_JAY291   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_JK9-3d   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_K11   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_Kyokai7   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_L1528   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_LalvinQA23   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_PW5   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_RM11-1a   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_RedStar   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_SEY6210   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_T7   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_T73   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_UC5   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_UWOPS05_217_3   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_VL3   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_Vin13   
   --------------------------------------------------   
YJR148W_W303   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_X2180-1A   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_Y10   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_Y55   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_YJM269   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_YJM339   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_YJM789   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_YPS128   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_YPS163   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_YS9   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
YJR148W_ZTW1   301   TERSKNGELLEAFGSGTAAIVSPIKEIGWKGEQINIPLLPGEQTGPLAKE   350
         

YJR148W_S288C   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_AWRI1631   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_AWRI796   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_BC187   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_CBS7960   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_CEN.PK   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_CLIB215   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_CLIB324   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_EC1118   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_EC9-8   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_FY1679   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_FostersB   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_FostersO   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_JAY291   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_JK9-3d   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_K11   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_Kyokai7   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_L1528   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_LalvinQA23   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_PW5   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_RM11-1a   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_RedStar   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_SEY6210   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_T7   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_T73   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_UC5   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_UWOPS05_217_3   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_VL3   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_Vin13   
   --------------------------   
YJR148W_W303   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_X2180-1A   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_Y10   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_Y55   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_YJM269   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_YJM339   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_YJM789   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_YPS128   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_YPS163   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_YS9   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
YJR148W_ZTW1   351   VAQWINGIQYGETEHGNWSRVVTDLN   376
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YJR148W_S288C from SGD:

YJR148W_S288C [source=SGD]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 3356  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT AEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK CLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_AWRI1631 from AWRI:

YJR148W_AWRI1631 [source=AWRI]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_AWRI796 from AWRI:

YJR148W_AWRI796 [source=AWRI]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_BC187 from Stanford:

YJR148W_BC187 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4608  ..

       1  MTLAPLDASK VKITTTRHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_CBS7960 from WashU:

YJR148W_CBS7960 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4447  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSIINLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_CEN.PK from Stanford:

YJR148W_CEN.PK [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 3356  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT AEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK CLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_CLIB215 from WashU:

YJR148W_CLIB215 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_CLIB324 from WashU:

YJR148W_CLIB324 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4217  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK CLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_EC1118 from Genoscope:

YJR148W_EC1118 [source=Genoscope]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 5471  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICSP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_EC9-8 from ASinica:

YJR148W_EC9-8 [source=ASinica]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 3730  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT AEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_FY1679 from Stanford:

YJR148W_FY1679 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 3356  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT AEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK CLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_FostersB from AWRI:

YJR148W_FostersB [source=AWRI]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4607  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWXI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_FostersO from AWRI:

YJR148W_FostersO [source=AWRI]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4587  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWSI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_JAY291 from Duke:

YJR148W_JAY291 [source=Duke]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4447  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSIINLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_JK9-3d from Stanford:

YJR148W_JK9-3d [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 3356  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT AEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK CLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_K11 from Stanford:

YJR148W_K11 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4587  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWSI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_Kyokai7 from NRIB:

YJR148W_Kyokai7 [source=NRIB]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4587  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWSI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_L1528 from Stanford:

YJR148W_L1528 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_LalvinQA23 from AWRI:

YJR148W_LalvinQA23 [source=AWRI]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 5746  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICXP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_PW5 from WashU:

YJR148W_PW5 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_RM11-1a from Stanford:

YJR148W_RM11-1a [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_RedStar from Stanford:

YJR148W_RedStar [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4587  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWSI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_SEY6210 from Stanford:

YJR148W_SEY6210 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 3356  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT AEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK CLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_T7 from WashU:

YJR148W_T7 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_T73 from WashU:

YJR148W_T73 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4447  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSIINLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_UC5 from WashU:

YJR148W_UC5 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_UWOPS05_217_3 from Stanford:

YJR148W_UWOPS05_217_3 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4667  ..

       1  MTLTPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_VL3 from AWRI:

YJR148W_VL3 [source=AWRI]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 6538  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFXDHMLT XEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TXGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYXPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_Vin13 from AWRI:

YJR148W_Vin13 [source=AWRI]  Length: 160  Thu May 24 02:48:12 2018  Type: P  Check: 3566  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGFRGFHA*

Protein Sequence for YJR148W_W303 from Stanford:

YJR148W_W303 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 3356  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT AEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK CLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_X2180-1A from Stanford:

YJR148W_X2180-1A [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 3356  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT AEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK CLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_Y10 from WashU:

YJR148W_Y10 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_Y55 from Stanford:

YJR148W_Y55 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_YJM269 from WashU:

YJR148W_YJM269 [source=WashU]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_YJM339 from Stanford:

YJR148W_YJM339 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_YJM789 from Stanford:

YJR148W_YJM789 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_YPS128 from Stanford:

YJR148W_YPS128 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_YPS163 from Stanford:

YJR148W_YPS163 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_YS9 from Stanford:

YJR148W_YS9 [source=Stanford]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4587  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWSI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*

Protein Sequence for YJR148W_ZTW1 from Zhejiang:

YJR148W_ZTW1 [source=Zhejiang]  Length: 377  Thu May 24 02:48:12 2018  Type: P  Check: 4591  ..

       1  MTLAPLDASK VKITTTQHAS KPKPNSELVF GKSFTDHMLT VEWTAEKGWG

      51  TPEIKPYQNL SLDPSAVVFH YAFELFEGMK AYRTVDNKIT MFRPDMNMKR

     101  MNKSAQRICL PTFDPEELIT LIGKLIQQDK YLVPEGKGYS LYIRPTLIGT

     151  TAGLGVSTPD RALLYVICCP VGPYYKTGFK AVRLEATDYA TRAWPGGCGD

     201  KKLGANYAPC VLPQLQAASR GYQQNLWLFG PNNNITEVGT MNAFFVFKDS

     251  KTGKKELVTA PLDGTILEGV TRDSILNLAK ERLEPSEWTI SERYFTIGEV

     301  TERSKNGELL EAFGSGTAAI VSPIKEIGWK GEQINIPLLP GEQTGPLAKE

     351  VAQWINGIQY GETEHGNWSR VVTDLN*