TIM8/YJR135W-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YJR135W-A_S288C   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_AWRI1631   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_AWRI796   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_CBS7960   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_CLIB215   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_CLIB324   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_EC1118   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_EC9-8   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_FostersB   1   ------------MTLPKRKLLLSWRERTPNKKSRCQSINSLIYAXKKCVE   38
YJR135W-A_FostersO   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_JAY291   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_Kyokai7   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_LalvinQA23   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_PW5   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_T7   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_T73   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_UC5   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_VL3   1   ------------MTLPKRKLLLSWRERTPNKKSRCQSINSLIYASKKCVE   38
YJR135W-A_Vin13   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_Y10   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_YJM269   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_YJM789   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
YJR135W-A_ZTW1   1   MSSLSTSDLASLDDTSKKEIATFLEGENSKQKVQMSIHQFTNICFKKCVE   50
         

YJR135W-A_S288C   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_AWRI1631   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQTPVNMKPIYLSESLFS   100
YJR135W-A_AWRI796   51   SVNDSNLSSQEEQCLSNCVNRFXGY-------------------------   75
YJR135W-A_CBS7960   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_CLIB215   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_CLIB324   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_EC1118   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_EC9-8   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_FostersB   39   SVNDSNLGSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   75
YJR135W-A_FostersO   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_JAY291   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_Kyokai7   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_LalvinQA23   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_PW5   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_T7   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_T73   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_UC5   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_VL3   39   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   75
YJR135W-A_Vin13   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_Y10   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_YJM269   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_YJM789   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
YJR135W-A_ZTW1   51   SVNDSNLSSQEEQCLSNCVNRFLDTNIRIVNGLQNTR-------------   87
         

YJR135W-A_S288C   
   --   
YJR135W-A_AWRI1631   101   LP   102
YJR135W-A_AWRI796   
   --   
YJR135W-A_CBS7960   
   --   
YJR135W-A_CLIB215   
   --   
YJR135W-A_CLIB324   
   --   
YJR135W-A_EC1118   
   --   
YJR135W-A_EC9-8   
   --   
YJR135W-A_FostersB   
   --   
YJR135W-A_FostersO   
   --   
YJR135W-A_JAY291   
   --   
YJR135W-A_Kyokai7   
   --   
YJR135W-A_LalvinQA23   
   --   
YJR135W-A_PW5   
   --   
YJR135W-A_T7   
   --   
YJR135W-A_T73   
   --   
YJR135W-A_UC5   
   --   
YJR135W-A_VL3   
   --   
YJR135W-A_Vin13   
   --   
YJR135W-A_Y10   
   --   
YJR135W-A_YJM269   
   --   
YJR135W-A_YJM789   
   --   
YJR135W-A_ZTW1   
   --   
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YJR135W-A_S288C from SGD:

YJR135W-A_S288C [source=SGD]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_AWRI1631 from AWRI:

YJR135W-A_AWRI1631 [source=AWRI]  Length: 103  Sun Sep 24 11:34:51 2017  Type: P  Check: 8603  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQTPVNMK PIYLSESLFS

     101  LP*

Protein Sequence for YJR135W-A_AWRI796 from AWRI:

YJR135W-A_AWRI796 [source=AWRI]  Length: 76  Sun Sep 24 11:34:51 2017  Type: P  Check: 110  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFXGY*

Protein Sequence for YJR135W-A_CBS7960 from WashU:

YJR135W-A_CBS7960 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_CLIB215 from WashU:

YJR135W-A_CLIB215 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_CLIB324 from WashU:

YJR135W-A_CLIB324 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_EC1118 from Genoscope:

YJR135W-A_EC1118 [source=Genoscope]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_EC9-8 from ASinica:

YJR135W-A_EC9-8 [source=ASinica]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_FostersB from AWRI:

YJR135W-A_FostersB [source=AWRI]  Length: 76  Sun Sep 24 11:34:51 2017  Type: P  Check: 1791  ..

       1  MTLPKRKLLL SWRERTPNKK SRCQSINSLI YAXKKCVESV NDSNLGSQEE

      51  QCLSNCVNRF LDTNIRIVNG LQNTR*

Protein Sequence for YJR135W-A_FostersO from AWRI:

YJR135W-A_FostersO [source=AWRI]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_JAY291 from Duke:

YJR135W-A_JAY291 [source=Duke]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_Kyokai7 from NRIB:

YJR135W-A_Kyokai7 [source=NRIB]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_LalvinQA23 from AWRI:

YJR135W-A_LalvinQA23 [source=AWRI]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_PW5 from WashU:

YJR135W-A_PW5 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_T7 from WashU:

YJR135W-A_T7 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_T73 from WashU:

YJR135W-A_T73 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_UC5 from WashU:

YJR135W-A_UC5 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_VL3 from AWRI:

YJR135W-A_VL3 [source=AWRI]  Length: 76  Sun Sep 24 11:34:51 2017  Type: P  Check: 2178  ..

       1  MTLPKRKLLL SWRERTPNKK SRCQSINSLI YASKKCVESV NDSNLSSQEE

      51  QCLSNCVNRF LDTNIRIVNG LQNTR*

Protein Sequence for YJR135W-A_Vin13 from AWRI:

YJR135W-A_Vin13 [source=AWRI]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_Y10 from WashU:

YJR135W-A_Y10 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_YJM269 from WashU:

YJR135W-A_YJM269 [source=WashU]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_YJM789 from Stanford:

YJR135W-A_YJM789 [source=Stanford]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*

Protein Sequence for YJR135W-A_ZTW1 from Zhejiang:

YJR135W-A_ZTW1 [source=Zhejiang]  Length: 88  Sun Sep 24 11:34:51 2017  Type: P  Check: 3419  ..

       1  MSSLSTSDLA SLDDTSKKEI ATFLEGENSK QKVQMSIHQF TNICFKKCVE

      51  SVNDSNLSSQ EEQCLSNCVN RFLDTNIRIV NGLQNTR*