CCT5/YJR064W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YJR064W_S288C   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_AWRI1631   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_AWRI796   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_BC187   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_BY4741   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_BY4742   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_CEN.PK   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_CLIB215   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_D273-10B   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_DBVPG6044   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_EC1118   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_EC9-8   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_FL100   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_FY1679   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_FostersB   
   --------------------------------------------------   
YJR064W_FostersO   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHXLEAKKSH   50
YJR064W_JAY291   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_JK9-3d   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_K11   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_Kyokai7   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_L1528   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_LalvinQA23   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_RM11-1a   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_RedStar   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_SEY6210   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_SK1   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_T7   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_UC5   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_UWOPS05_217_3   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_VL3   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_Vin13   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_W303   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_X2180-1A   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_Y55   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_YJM269   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_YJM339   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_YJM789   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_YPH499   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_YPS128   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_YPS163   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_YS9   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
YJR064W_ZTW1   1   MAARPQQPPMEMPDLSNAIVAQDEMGRPFIIVKDQGNKKRQHGLEAKKSH   50
         

YJR064W_S288C   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_AWRI1631   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_AWRI796   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_BC187   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_BY4741   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_BY4742   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_CEN.PK   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_CLIB215   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_D273-10B   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_DBVPG6044   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_EC1118   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_EC9-8   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_FL100   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_FY1679   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_FostersB   
   --------------------------------------------------   
YJR064W_FostersO   51   ILAARSVASIIKTSLGPRGLDKILISPDGEIXITNDGATILSQMELDNEI   100
YJR064W_JAY291   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_JK9-3d   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_K11   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_Kyokai7   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_L1528   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_LalvinQA23   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_RM11-1a   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_RedStar   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_SEY6210   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_SK1   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_T7   51   ILAARSVASIIKTSLGPRGSDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_UC5   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_UWOPS05_217_3   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_VL3   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_Vin13   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_W303   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_X2180-1A   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_Y55   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_YJM269   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_YJM339   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_YJM789   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_YPH499   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_YPS128   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_YPS163   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_YS9   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
YJR064W_ZTW1   51   ILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEI   100
         

YJR064W_S288C   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_AWRI1631   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_AWRI796   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_BC187   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_BY4741   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_BY4742   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_CEN.PK   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_CLIB215   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_D273-10B   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_DBVPG6044   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_EC1118   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_EC9-8   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_FL100   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_FY1679   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_FostersB   
   --------------------------------------------------   
YJR064W_FostersO   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_JAY291   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_JK9-3d   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_K11   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_Kyokai7   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_L1528   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_LalvinQA23   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_RM11-1a   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_RedStar   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_SEY6210   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_SK1   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_T7   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_UC5   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_UWOPS05_217_3   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_VL3   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_Vin13   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_W303   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_X2180-1A   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_Y55   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_YJM269   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_YJM339   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_YJM789   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_YPH499   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_YPS128   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_YPS163   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_YS9   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
YJR064W_ZTW1   101   AKLLVQLSKSQDDEIGDGTTGVVVLASALLDQALELIQKGIHPIKIANGF   150
         

YJR064W_S288C   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_AWRI1631   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_AWRI796   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_BC187   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_BY4741   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_BY4742   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_CEN.PK   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_CLIB215   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_D273-10B   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_DBVPG6044   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_EC1118   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_EC9-8   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_FL100   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_FY1679   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_FostersB   
   --------------------------------------------------   
YJR064W_FostersO   151   XEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_JAY291   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_JK9-3d   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_K11   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_Kyokai7   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_L1528   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_LalvinQA23   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_RM11-1a   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_RedStar   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_SEY6210   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_SK1   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_T7   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_UC5   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_UWOPS05_217_3   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_VL3   151   XEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_Vin13   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_W303   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_X2180-1A   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_Y55   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_YJM269   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_YJM339   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_YJM789   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_YPH499   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_YPS128   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_YPS163   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_YS9   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
YJR064W_ZTW1   151   DEAAKLAISKLEETCDDISASNDELFRDFLLRAAKTSLGSKIVSKDHDRF   200
         

YJR064W_S288C   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_AWRI1631   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_AWRI796   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_BC187   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_BY4741   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_BY4742   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_CEN.PK   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_CLIB215   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_D273-10B   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_DBVPG6044   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_EC1118   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_EC9-8   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_FL100   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_FY1679   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_FostersB   
   --------------------------------------------------   
YJR064W_FostersO   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_JAY291   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_JK9-3d   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_K11   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_Kyokai7   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_L1528   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_LalvinQA23   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_RM11-1a   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_RedStar   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_SEY6210   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_SK1   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_T7   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_UC5   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_UWOPS05_217_3   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_VL3   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_Vin13   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_W303   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_X2180-1A   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_Y55   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_YJM269   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_YJM339   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_YJM789   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_YPH499   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_YPS128   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_YPS163   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_YS9   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
YJR064W_ZTW1   201   AEMAVEAVINVMDKDRKDVDFDLIKMQGRVGGSISDSKLINGVILDKDFS   250
         

YJR064W_S288C   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_AWRI1631   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_AWRI796   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_BC187   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_BY4741   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_BY4742   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_CEN.PK   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_CLIB215   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_D273-10B   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_DBVPG6044   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_EC1118   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_EC9-8   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_FL100   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_FY1679   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_FostersB   
   --------------------------------------------------   
YJR064W_FostersO   251   HPQMPKCVLPKEGSDGVKXAILXCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_JAY291   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_JK9-3d   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_K11   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_Kyokai7   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_L1528   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_LalvinQA23   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_RM11-1a   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_RedStar   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_SEY6210   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_SK1   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_T7   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_UC5   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_UWOPS05_217_3   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_VL3   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_Vin13   251   HPQMPKCVLPKEGSDGVKLAILTCPFETS---------------------   279
YJR064W_W303   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_X2180-1A   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_Y55   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_YJM269   251   HPQMPKCVLPKEGSDGVKLAVLTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_YJM339   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_YJM789   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_YPH499   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_YPS128   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_YPS163   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_YS9   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
YJR064W_ZTW1   251   HPQMPKCVLPKEGSDGVKLAILTCPFEPPKPKTKHKLDISSVEEYQKLQT   300
         

YJR064W_S288C   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_AWRI1631   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_AWRI796   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_BC187   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_BY4741   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_BY4742   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_CEN.PK   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_CLIB215   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_D273-10B   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_DBVPG6044   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_EC1118   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_EC9-8   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_FL100   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_FY1679   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_FostersB   1   ------------------MLLYAXWGFDDEANHLLLQNDLPAVRWVGGQE   32
YJR064W_FostersO   301   YEQDKFKEMIDDVKKAXADVVICQWGFDDEANHLLLQNDLPAVRWVXGQE   350
YJR064W_JAY291   301   YEQDKFKEMIDHVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_JK9-3d   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_K11   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_Kyokai7   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_L1528   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_LalvinQA23   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_RM11-1a   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_RedStar   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_SEY6210   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_SK1   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_T7   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_UC5   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_UWOPS05_217_3   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_VL3   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_Vin13   
   --------------------------------------------------   
YJR064W_W303   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_X2180-1A   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_Y55   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_YJM269   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_YJM339   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_YJM789   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_YPH499   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_YPS128   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_YPS163   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_YS9   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
YJR064W_ZTW1   301   YEQDKFKEMIDDVKKAGADVVICQWGFDDEANHLLLQNDLPAVRWVGGQE   350
         

YJR064W_S288C   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_AWRI1631   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_AWRI796   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_BC187   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_BY4741   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_BY4742   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_CEN.PK   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_CLIB215   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_D273-10B   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_DBVPG6044   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_EC1118   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_EC9-8   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_FL100   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_FY1679   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_FostersB   33   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   82
YJR064W_FostersO   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_JAY291   351   LEHIAISTNGRIVPRFKDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_JK9-3d   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_K11   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_Kyokai7   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_L1528   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_LalvinQA23   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_RM11-1a   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_RedStar   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_SEY6210   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_SK1   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_T7   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_UC5   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_UWOPS05_217_3   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_VL3   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_Vin13   
   --------------------------------------------------   
YJR064W_W303   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_X2180-1A   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_Y55   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_YJM269   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_YJM339   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_YJM789   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_YPH499   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_YPS128   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_YPS163   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_YS9   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
YJR064W_ZTW1   351   LEHIAISTNGRIVPRFQDLSKDKLGTCSRIYEQEFGTTKDRMLIIEQSKE   400
         

YJR064W_S288C   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_AWRI1631   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_AWRI796   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_BC187   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_BY4741   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_BY4742   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_CEN.PK   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_CLIB215   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_D273-10B   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_DBVPG6044   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_EC1118   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_EC9-8   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_FL100   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_FY1679   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_FostersB   83   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKXSRVVYGGGAAEVTM   132
YJR064W_FostersO   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_JAY291   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_JK9-3d   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_K11   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_Kyokai7   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_L1528   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_LalvinQA23   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_RM11-1a   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_RedStar   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_SEY6210   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_SK1   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_T7   401   TKNVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_UC5   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_UWOPS05_217_3   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEMTM   450
YJR064W_VL3   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_Vin13   
   --------------------------------------------------   
YJR064W_W303   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_X2180-1A   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_Y55   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_YJM269   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_YJM339   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_YJM789   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_YPH499   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_YPS128   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_YPS163   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_YS9   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
YJR064W_ZTW1   401   TKTVTCFVRGSNKMIVDEAERALHDSLCVVRNLVKDSRVVYGGGAAEVTM   450
         

YJR064W_S288C   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_AWRI1631   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_AWRI796   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_BC187   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_BY4741   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_BY4742   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_CEN.PK   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_CLIB215   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_D273-10B   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_DBVPG6044   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_EC1118   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_EC9-8   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_FL100   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_FY1679   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_FostersB   133   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   182
YJR064W_FostersO   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_JAY291   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_JK9-3d   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_K11   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_Kyokai7   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_L1528   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_LalvinQA23   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_RM11-1a   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_RedStar   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_SEY6210   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_SK1   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_T7   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_UC5   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_UWOPS05_217_3   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_VL3   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_Vin13   
   --------------------------------------------------   
YJR064W_W303   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_X2180-1A   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_Y55   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_YJM269   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_YJM339   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_YJM789   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_YPH499   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_YPS128   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_YPS163   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_YS9   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
YJR064W_ZTW1   451   SLAVSEEADKQRGIDQYAFRGFAQALDTIPMTLAENSGLDPIGTLSTLKS   500
         

YJR064W_S288C   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_AWRI1631   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_AWRI796   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_BC187   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_BY4741   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_BY4742   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_CEN.PK   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_CLIB215   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_D273-10B   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_DBVPG6044   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_EC1118   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_EC9-8   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_FL100   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_FY1679   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_FostersB   183   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   232
YJR064W_FostersO   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_JAY291   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_JK9-3d   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_K11   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_Kyokai7   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_L1528   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_LalvinQA23   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_RM11-1a   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_RedStar   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_SEY6210   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_SK1   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_T7   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_UC5   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_UWOPS05_217_3   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_VL3   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_Vin13   
   --------------------------------------------------   
YJR064W_W303   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_X2180-1A   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_Y55   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_YJM269   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_YJM339   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_YJM789   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_YPH499   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_YPS128   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_YPS163   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_YS9   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
YJR064W_ZTW1   501   KQLKEKISNIGVDCLGYGSNDMKELFVVDPFIGKKQQILLATQLCRMILK   550
         

YJR064W_S288C   551   IDNVIISGKDEY   562
YJR064W_AWRI1631   551   IDNVIISGKDEY   562
YJR064W_AWRI796   551   IDNVIISGKDEY   562
YJR064W_BC187   551   IDNVIISGKDEY   562
YJR064W_BY4741   551   IDNVIISGKDEY   562
YJR064W_BY4742   551   IDNVIISGKDEY   562
YJR064W_CEN.PK   551   IDNVIISGKDEY   562
YJR064W_CLIB215   551   IDNVIISGKDEY   562
YJR064W_D273-10B   551   IDNVIISGKDEY   562
YJR064W_DBVPG6044   551   IDNVIISGKDEY   562
YJR064W_EC1118   551   IDNVIISGKDEY   562
YJR064W_EC9-8   551   IDNVIISGKDEY   562
YJR064W_FL100   551   IDNVIISGKDEY   562
YJR064W_FY1679   551   IDNVIISGKDEY   562
YJR064W_FostersB   233   IDNVIISGKDEY   244
YJR064W_FostersO   551   IDNVIISGKDEY   562
YJR064W_JAY291   551   IDNVIISGKDEY   562
YJR064W_JK9-3d   551   IDNVIISGKDEY   562
YJR064W_K11   551   IDNVIISGKDEY   562
YJR064W_Kyokai7   551   IDNVIISGKDEY   562
YJR064W_L1528   551   IDNVIISGKDEY   562
YJR064W_LalvinQA23   551   IDNVIISGKDEY   562
YJR064W_RM11-1a   551   IDNVIISGKDEY   562
YJR064W_RedStar   551   IDNVIISGKDEY   562
YJR064W_SEY6210   551   IDNVIISGKDEY   562
YJR064W_SK1   551   IDNVIISGKDEY   562
YJR064W_T7   551   IDNVIISGKDEY   562
YJR064W_UC5   551   IDNVIISGKDEY   562
YJR064W_UWOPS05_217_3   551   IDNVIISGKDEY   562
YJR064W_VL3   551   IDNVIISGKDEY   562
YJR064W_Vin13   
   ------------   
YJR064W_W303   551   IDNVIISGKDEY   562
YJR064W_X2180-1A   551   IDNVIISGKDEY   562
YJR064W_Y55   551   IDNVIISGKDEY   562
YJR064W_YJM269   551   IDNVIISGKDEY   562
YJR064W_YJM339   551   IDNVIISGKDEY   562
YJR064W_YJM789   551   IDNVIISGKDEY   562
YJR064W_YPH499   551   IDNVIISGKDEY   562
YJR064W_YPS128   551   IDNVIISGKDEY   562
YJR064W_YPS163   551   IDNVIISGKDEY   562
YJR064W_YS9   551   IDNVIISGKDEY   562
YJR064W_ZTW1   551   IDNVIISGKDEY   562
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YJR064W_S288C from SGD:

YJR064W_S288C [source=SGD]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTCFVRG SNKMIVDEAE RALHDSLCVV RNLVKDSRVV YGGGAAEVTM

     451  SLAVSEEADK QRGIDQYAFR GFAQALDTIP MTLAENSGLD PIGTLSTLKS

     501  KQLKEKISNI GVDCLGYGSN DMKELFVVDP FIGKKQQILL ATQLCRMILK

     551  IDNVIISGKD EY*

Protein Sequence for YJR064W_AWRI1631 from AWRI:

YJR064W_AWRI1631 [source=AWRI]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTCFVRG SNKMIVDEAE RALHDSLCVV RNLVKDSRVV YGGGAAEVTM

     451  SLAVSEEADK QRGIDQYAFR GFAQALDTIP MTLAENSGLD PIGTLSTLKS

     501  KQLKEKISNI GVDCLGYGSN DMKELFVVDP FIGKKQQILL ATQLCRMILK

     551  IDNVIISGKD EY*

Protein Sequence for YJR064W_AWRI796 from AWRI:

YJR064W_AWRI796 [source=AWRI]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTCFVRG SNKMIVDEAE RALHDSLCVV RNLVKDSRVV YGGGAAEVTM

     451  SLAVSEEADK QRGIDQYAFR GFAQALDTIP MTLAENSGLD PIGTLSTLKS

     501  KQLKEKISNI GVDCLGYGSN DMKELFVVDP FIGKKQQILL ATQLCRMILK

     551  IDNVIISGKD EY*

Protein Sequence for YJR064W_BC187 from Stanford:

YJR064W_BC187 [source=Stanford]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTCFVRG SNKMIVDEAE RALHDSLCVV RNLVKDSRVV YGGGAAEVTM

     451  SLAVSEEADK QRGIDQYAFR GFAQALDTIP MTLAENSGLD PIGTLSTLKS

     501  KQLKEKISNI GVDCLGYGSN DMKELFVVDP FIGKKQQILL ATQLCRMILK

     551  IDNVIISGKD EY*

Protein Sequence for YJR064W_BY4741 from Stanford:

YJR064W_BY4741 [source=Stanford]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTCFVRG SNKMIVDEAE RALHDSLCVV RNLVKDSRVV YGGGAAEVTM

     451  SLAVSEEADK QRGIDQYAFR GFAQALDTIP MTLAENSGLD PIGTLSTLKS

     501  KQLKEKISNI GVDCLGYGSN DMKELFVVDP FIGKKQQILL ATQLCRMILK

     551  IDNVIISGKD EY*

Protein Sequence for YJR064W_BY4742 from Stanford:

YJR064W_BY4742 [source=Stanford]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTCFVRG SNKMIVDEAE RALHDSLCVV RNLVKDSRVV YGGGAAEVTM

     451  SLAVSEEADK QRGIDQYAFR GFAQALDTIP MTLAENSGLD PIGTLSTLKS

     501  KQLKEKISNI GVDCLGYGSN DMKELFVVDP FIGKKQQILL ATQLCRMILK

     551  IDNVIISGKD EY*

Protein Sequence for YJR064W_CEN.PK from Stanford:

YJR064W_CEN.PK [source=Stanford]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTCFVRG SNKMIVDEAE RALHDSLCVV RNLVKDSRVV YGGGAAEVTM

     451  SLAVSEEADK QRGIDQYAFR GFAQALDTIP MTLAENSGLD PIGTLSTLKS

     501  KQLKEKISNI GVDCLGYGSN DMKELFVVDP FIGKKQQILL ATQLCRMILK

     551  IDNVIISGKD EY*

Protein Sequence for YJR064W_CLIB215 from WashU:

YJR064W_CLIB215 [source=WashU]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTCFVRG SNKMIVDEAE RALHDSLCVV RNLVKDSRVV YGGGAAEVTM

     451  SLAVSEEADK QRGIDQYAFR GFAQALDTIP MTLAENSGLD PIGTLSTLKS

     501  KQLKEKISNI GVDCLGYGSN DMKELFVVDP FIGKKQQILL ATQLCRMILK

     551  IDNVIISGKD EY*

Protein Sequence for YJR064W_D273-10B from Stanford:

YJR064W_D273-10B [source=Stanford]  Length: 563  Tue Sep 19 16:34:03 2017  Type: P  Check: 3512  ..

       1  MAARPQQPPM EMPDLSNAIV AQDEMGRPFI IVKDQGNKKR QHGLEAKKSH

      51  ILAARSVASI IKTSLGPRGL DKILISPDGE ITITNDGATI LSQMELDNEI

     101  AKLLVQLSKS QDDEIGDGTT GVVVLASALL DQALELIQKG IHPIKIANGF

     151  DEAAKLAISK LEETCDDISA SNDELFRDFL LRAAKTSLGS KIVSKDHDRF

     201  AEMAVEAVIN VMDKDRKDVD FDLIKMQGRV GGSISDSKLI NGVILDKDFS

     251  HPQMPKCVLP KEGSDGVKLA ILTCPFEPPK PKTKHKLDIS SVEEYQKLQT

     301  YEQDKFKEMI DDVKKAGADV VICQWGFDDE ANHLLLQNDL PAVRWVGGQE

     351  LEHIAISTNG RIVPRFQDLS KDKLGTCSRI YEQEFGTTKD RMLIIEQSKE

     401  TKTVTC