QCR8/YJL166W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YJL166W_S288C   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_AWRI1631   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_AWRI796   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_CBS7960   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_CLIB215   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_CLIB324   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_EC1118   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_EC9-8   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_FostersB   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_FostersO   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_JAY291   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_Kyokai7   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_LalvinQA23   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_M22   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_PW5   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_T7   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_T73   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_UC5   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_VL3   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_Vin13   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_Y10   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_YJM269   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_YJM789   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
YJL166W_ZTW1   1   MGPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFR   50
         

YJL166W_S288C   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_AWRI1631   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_AWRI796   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_CBS7960   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_CLIB215   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_CLIB324   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_EC1118   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_EC9-8   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_FostersB   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_FostersO   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_JAY291   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_Kyokai7   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_LalvinQA23   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_M22   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_PW5   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_T7   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_T73   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_UC5   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_VL3   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_Vin13   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_Y10   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_YJM269   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_YJM789   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
YJL166W_ZTW1   51   RFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV   94
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YJL166W_S288C from SGD:

YJL166W_S288C [source=SGD]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_AWRI1631 from AWRI:

YJL166W_AWRI1631 [source=AWRI]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_AWRI796 from AWRI:

YJL166W_AWRI796 [source=AWRI]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_CBS7960 from WashU:

YJL166W_CBS7960 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_CLIB215 from WashU:

YJL166W_CLIB215 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_CLIB324 from WashU:

YJL166W_CLIB324 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_EC1118 from Genoscope:

YJL166W_EC1118 [source=Genoscope]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_EC9-8 from ASinica:

YJL166W_EC9-8 [source=ASinica]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_FostersB from AWRI:

YJL166W_FostersB [source=AWRI]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_FostersO from AWRI:

YJL166W_FostersO [source=AWRI]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_JAY291 from Duke:

YJL166W_JAY291 [source=Duke]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_Kyokai7 from NRIB:

YJL166W_Kyokai7 [source=NRIB]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_LalvinQA23 from AWRI:

YJL166W_LalvinQA23 [source=AWRI]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_M22 from WashU:

YJL166W_M22 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_PW5 from WashU:

YJL166W_PW5 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_T7 from WashU:

YJL166W_T7 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_T73 from WashU:

YJL166W_T73 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_UC5 from WashU:

YJL166W_UC5 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_VL3 from AWRI:

YJL166W_VL3 [source=AWRI]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_Vin13 from AWRI:

YJL166W_Vin13 [source=AWRI]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_Y10 from WashU:

YJL166W_Y10 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_YJM269 from WashU:

YJL166W_YJM269 [source=WashU]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_YJM789 from Stanford:

YJL166W_YJM789 [source=Stanford]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*


Protein Sequence for YJL166W_ZTW1 from Zhejiang:

YJL166W_ZTW1 [source=Zhejiang]  Length: 95  Fri Sep 22 11:44:26 2017  Type: P  Check: 3004  ..

       1  MGPPSGKTYM GWWGHMGGPK QKGITSYAVS PYAQKPLQGI FHNAVFNSFR

      51  RFKSQFLYVL IPAGIYWYWW KNGNEYNEFL YSKAGREELE RVNV*