CST6/YIL036W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YIL036W_S288C   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSVSDTSAAATT   49
YIL036W_AWRI796   
   --------------------------------------------------   
YIL036W_CBS7960   
   --------------------------------------------------   
YIL036W_CLIB215   1   -MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAAA   49
YIL036W_DBVPG6044   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_EC1118   1   -MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAAA   49
YIL036W_EC9-8   1   MFTGQEDHSVDSNSTKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAAAT   50
YIL036W_FL100   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_FY1679   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSVSDTSAAATT   49
YIL036W_FostersB   
   --------------------------------------------------   
YIL036W_FostersO   
   --------------------------------------------------   
YIL036W_JAY291   1   MFTGQEDHSVDSNSSKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAAAT   50
YIL036W_JK9-3d   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_K11   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_Kyokai7   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAPT   49
YIL036W_LalvinQA23   
   --------------------------------------------------   
YIL036W_PW5   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_RedStar   
   --------------------------------------------------   
YIL036W_SEY6210   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSVSDTSAAATT   49
YIL036W_SK1   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_T7   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_T73   1   -MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAAA   49
YIL036W_UWOPS05_217_3   1   -MFTGQEYHSVDSNSTKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_VL3   
   --------------------------------------------------   
YIL036W_Vin13   1   -MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAAA   49
YIL036W_W303   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSVSDTSAAATT   49
YIL036W_X2180-1A   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSVSDTSAAATT   49
YIL036W_Y55   1   -MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAAA   49
YIL036W_YJM269   1   -MFTGQEYHSVDSNSTKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_YJM339   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_YJM789   1   -MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKILNNKIPHSISDTSAAAAA   49
YIL036W_YPS128   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_YPS163   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
YIL036W_ZTW1   1   -MFTGQEYHSVDSNSNKQKDNNKRGIDDTSKILNNKIPHSISDTSAAATT   49
         

YIL036W_S288C   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_AWRI796   
   --------------------------------------------------   
YIL036W_CBS7960   1   ---MNN-SALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   46
YIL036W_CLIB215   50   TTSTMNNSALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   99
YIL036W_DBVPG6044   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_EC1118   50   TTSTMNNSALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   99
YIL036W_EC9-8   51   TSTMNN-SALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   99
YIL036W_FL100   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_FY1679   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_FostersB   
   --------------------------------------------------   
YIL036W_FostersO   
   --------------------------------------------------   
YIL036W_JAY291   51   TSTMNN-SALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   99
YIL036W_JK9-3d   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_K11   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_Kyokai7   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_LalvinQA23   
   --------------------------------------------------   
YIL036W_PW5   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_RedStar   
   --------------------------------------------------   
YIL036W_SEY6210   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_SK1   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_T7   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_T73   50   TTSTMNNSALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   99
YIL036W_UWOPS05_217_3   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_VL3   
   --------------------------------------------------   
YIL036W_Vin13   50   TTSTMNNSALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   99
YIL036W_W303   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_X2180-1A   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_Y55   50   TTSTMNNSALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   99
YIL036W_YJM269   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_YJM339   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_YJM789   50   TTSTMNNSALSRSLDPTDINYNTNMAGVVDQIHDYTTSNRNSLTPQYSIA   99
YIL036W_YPS128   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_YPS163   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
YIL036W_ZTW1   50   TSTMNN-SALSRSLDPTDINYSTNMAGVVDQIHDYTTSNRNSLTPQYSIA   98
         

YIL036W_S288C   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_AWRI796   
   --------------------------------------------------   
YIL036W_CBS7960   47   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   96
YIL036W_CLIB215   100   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   149
YIL036W_DBVPG6044   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_EC1118   100   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   149
YIL036W_EC9-8   100   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   149
YIL036W_FL100   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYD   148
YIL036W_FY1679   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_FostersB   
   --------------------------------------------------   
YIL036W_FostersO   
   --------------------------------------------------   
YIL036W_JAY291   100   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   149
YIL036W_JK9-3d   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYD   148
YIL036W_K11   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYD   148
YIL036W_Kyokai7   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYD   148
YIL036W_LalvinQA23   
   --------------------------------------------------   
YIL036W_PW5   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_RedStar   1   ---------------------------------------MKTEEESQLYG   11
YIL036W_SEY6210   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_SK1   99   AGNVNSHDQVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYD   148
YIL036W_T7   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_T73   100   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   149
YIL036W_UWOPS05_217_3   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_VL3   
   --------------------------------------------------   
YIL036W_Vin13   100   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   149
YIL036W_W303   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_X2180-1A   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_Y55   100   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   149
YIL036W_YJM269   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_YJM339   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_YJM789   100   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   149
YIL036W_YPS128   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_YPS163   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYG   148
YIL036W_ZTW1   99   AGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQRQQSPSMKTEEESQLYD   148
         

YIL036W_S288C   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_AWRI796   
   --------------------------------------------------   
YIL036W_CBS7960   97   DILMNPGVVQDMHQNLAPSYNLSQLSSTRKSAPNDSTTAPTNASNIANTA   146
YIL036W_CLIB215   150   DILMNPGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   199
YIL036W_DBVPG6044   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_EC1118   150   DILMNPGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   199
YIL036W_EC9-8   150   DILMNSSVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   199
YIL036W_FL100   149   DILMNPGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_FY1679   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_FostersB   
   --------------------------------------------------   
YIL036W_FostersO   
   --------------------------------------------------   
YIL036W_JAY291   150   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   199
YIL036W_JK9-3d   149   DILMNPGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_K11   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_Kyokai7   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_LalvinQA23   
   --------------------------------------------------   
YIL036W_PW5   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_RedStar   12   DILMNPGVVQDMHQNLATHTNLSQLSYTRKSAPNDSTTAPTNASNIANTA   61
YIL036W_SEY6210   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_SK1   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_T7   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_T73   150   DILMNPGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   199
YIL036W_UWOPS05_217_3   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_VL3   
   --------------------------------------------------   
YIL036W_Vin13   150   DILMNPGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   199
YIL036W_W303   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_X2180-1A   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_Y55   150   DILMNPGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   199
YIL036W_YJM269   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
YIL036W_YJM339   149   DILMNSGVVQDMHQNLATHTNLNQLSSSRKSASNDSTTAPTNASNIANTA   198
YIL036W_YJM789   150   DILMNPGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   199
YIL036W_YPS128   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTKAPTNASNIANTA   198
YIL036W_YPS163   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTKAPTNASNIANTA   198
YIL036W_ZTW1   149   DILMNSGVVQDMHQNLATHTNLSQLSSTRKSAPNDSTTAPTNASNIANTA   198
         

YIL036W_S288C   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_AWRI796   
   --------------------------------------------------   
YIL036W_CBS7960   147   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   196
YIL036W_CLIB215   200   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   249
YIL036W_DBVPG6044   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVGVAHLPMTNPPI   248
YIL036W_EC1118   200   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   249
YIL036W_EC9-8   200   SVNKQMYFMNMNMNNNPHALNDPSILETLLPFFQPFGVDVAHLPMTNPPI   249
YIL036W_FL100   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_FY1679   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_FostersB   
   --------------------------------------------------   
YIL036W_FostersO   
   --------------------------------------------------   
YIL036W_JAY291   200   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   249
YIL036W_JK9-3d   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_K11   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_Kyokai7   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_LalvinQA23   
   --------------------------------------------------   
YIL036W_PW5   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_RedStar   62   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   111
YIL036W_SEY6210   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_SK1   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_T7   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_T73   200   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   249
YIL036W_UWOPS05_217_3   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_VL3   
   --------------------------------------------------   
YIL036W_Vin13   200   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   249
YIL036W_W303   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_X2180-1A   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_Y55   200   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   249
YIL036W_YJM269   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_YJM339   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_YJM789   200   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   249
YIL036W_YPS128   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_YPS163   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
YIL036W_ZTW1   199   SVNKQMYFMNMNMNNNPHALNDPSILETLSPFFQPFGVDVAHLPMTNPPI   248
         

YIL036W_S288C   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_AWRI796   
   --------------------------------------------------   
YIL036W_CBS7960   197   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   246
YIL036W_CLIB215   250   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   299
YIL036W_DBVPG6044   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_EC1118   250   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   299
YIL036W_EC9-8   250   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   299
YIL036W_FL100   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_FY1679   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_FostersB   
   --------------------------------------------------   
YIL036W_FostersO   
   --------------------------------------------------   
YIL036W_JAY291   250   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   299
YIL036W_JK9-3d   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_K11   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_Kyokai7   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_LalvinQA23   1   --------------------------------------------MPNFHN   6
YIL036W_PW5   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_RedStar   112   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   161
YIL036W_SEY6210   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_SK1   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_T7   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_T73   250   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   299
YIL036W_UWOPS05_217_3   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_VL3   
   --------------------------------------------------   
YIL036W_Vin13   250   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   299
YIL036W_W303   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_X2180-1A   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_Y55   250   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   299
YIL036W_YJM269   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_YJM339   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_YJM789   250   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   299
YIL036W_YPS128   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_YPS163   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
YIL036W_ZTW1   249   FQSSLPGCDEPIRRRRISISNGQISQLGEDIETLENLHNTQPPPMPNFHN   298
         

YIL036W_S288C   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_AWRI796   1   ------------------MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKIL   32
YIL036W_CBS7960   247   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   296
YIL036W_CLIB215   300   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   349
YIL036W_DBVPG6044   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_EC1118   300   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   349
YIL036W_EC9-8   300   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   349
YIL036W_FL100   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSTLGDQNVIYS   348
YIL036W_FY1679   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_FostersB   1   ------------------MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKIL   32
YIL036W_FostersO   1   ------------------MFTGQEYHSVDSNSSKQKDNNKRGIDDTSKIL   32
YIL036W_JAY291   300   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   349
YIL036W_JK9-3d   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSTLGDQNVIYS   348
YIL036W_K11   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSTLGDQNVIYS   348
YIL036W_Kyokai7   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSTLGDQNVIYS   348
YIL036W_LalvinQA23   7   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   56
YIL036W_PW5   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_RedStar   162   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSTLGDQNVIYS   211
YIL036W_SEY6210   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_SK1   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_T7   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_T73   300   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTEDSALGDQSVIYS   349
YIL036W_UWOPS05_217_3   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQNVIYS   348
YIL036W_VL3   1   --------MYQTSRSSTKQCRLVVFHNTMTKKVINPTKDSALGDQSVIYS   42
YIL036W_Vin13   300   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   349
YIL036W_W303   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_X2180-1A   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_Y55   300   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   349
YIL036W_YJM269   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_YJM339   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQNVIYS   348
YIL036W_YJM789   300   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   349
YIL036W_YPS128   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_YPS163   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSALGDQSVIYS   348
YIL036W_ZTW1   299   YNGLSQTRNVSNKPVFNQAVPVSSIPQYNAKKVINPTKDSTLGDQNVIYS   348
         

YIL036W_S288C   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   398
YIL036W_AWRI796   33   NNKIPHSISDTSAAAAATTSTMNNSALSRSLDPTDINYNTNMAGVVDQIH   82
YIL036W_CBS7960   297   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   346
YIL036W_CLIB215   350   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   399
YIL036W_DBVPG6044   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_EC1118   350   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSAPRESHSNP   399
YIL036W_EC9-8   350   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   399
YIL036W_FL100   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_FY1679   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   398
YIL036W_FostersB   33   NNKIPHSISDTSAAAAATTSTMNNSALSRSLDPTDINYNTNMAGVVDQIH   82
YIL036W_FostersO   33   NNKIPHSISDTSAAAAATTSTMNNSALSRSLDPTDINYNTNMAGVVDQIH   82
YIL036W_JAY291   350   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   399
YIL036W_JK9-3d   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_K11   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_Kyokai7   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_LalvinQA23   57   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSAXRESHSNP   106
YIL036W_PW5   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_RedStar   212   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   261
YIL036W_SEY6210   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   398
YIL036W_SK1   349   KSQQPNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   398
YIL036W_T7   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_T73   350   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   399
YIL036W_UWOPS05_217_3   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTDGENRGKSALRESHSNP   398
YIL036W_VL3   43   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   92
YIL036W_Vin13   350   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   399
YIL036W_W303   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   398
YIL036W_X2180-1A   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   398
YIL036W_Y55   350   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   399
YIL036W_YJM269   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_YJM339   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_YJM789   350   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTGGENRGKSALRESHSNP   399
YIL036W_YPS128   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_YPS163   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
YIL036W_ZTW1   349   KSQQRNFVNAPSKNTPAESISDLEGMTTFAPTTEGENRGKSALRESHSNP   398
         

YIL036W_S288C   399   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_AWRI796   83   DYTTSNRNSLTPQYSIAAGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQ   132
YIL036W_CBS7960   347   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   396
YIL036W_CLIB215   400   SFTSKSQGSHLNLAANTQGNPIPGTTAWKKARLLERNRIAASKCRQRKKV   449
YIL036W_DBVPG6044   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_EC1118   400   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   449
YIL036W_EC9-8   400   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   449
YIL036W_FL100   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_FY1679   399   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_FostersB   83   DYTTSNRNSLTPQYSIAAGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQ   132
YIL036W_FostersO   83   DYTTSNRNSLTPQYSIAAGNVNSHDRVVKPSANSNYQQAAYLRQQQQQDQ   132
YIL036W_JAY291   400   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   449
YIL036W_JK9-3d   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_K11   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_Kyokai7   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_LalvinQA23   107   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   156
YIL036W_PW5   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_RedStar   262   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   311
YIL036W_SEY6210   399   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_SK1   399   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_T7   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_T73   400   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   449
YIL036W_UWOPS05_217_3   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_VL3   93   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   142
YIL036W_Vin13   400   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   449
YIL036W_W303   399   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_X2180-1A   399   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_Y55   400   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   449
YIL036W_YJM269   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_YJM339   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_YJM789   400   SFTPKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   449
YIL036W_YPS128   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_YPS163   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
YIL036W_ZTW1   399   SFTSKSQGSHLNLAANTQGNPIPGTTAWKRARLLERNRIAASKCRQRKKV   448
         

YIL036W_S288C   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_AWRI796   133   RQQSPSMKTEEESQLYGDILMNPGVVQDMHQNLATHTNLSQLSSTRKSAP   182
YIL036W_CBS7960   397   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   446
YIL036W_CLIB215   450   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   499
YIL036W_DBVPG6044   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_EC1118   450   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   499
YIL036W_EC9-8   450   AHLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   499
YIL036W_FL100   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_FY1679   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_FostersB   133   RQQSPSMKTEEESQLYGDILMNPGVVQDMHQNLATHTNLSQLSSTRKSAP   182
YIL036W_FostersO   133   RQQSPSMKTEEESQLYGDILMNPGVVQDMHQNLATHTNLSQLSSTRKSAP   182
YIL036W_JAY291   450   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   499
YIL036W_JK9-3d   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_K11   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_Kyokai7   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_LalvinQA23   157   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   206
YIL036W_PW5   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_RedStar   312   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   361
YIL036W_SEY6210   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_SK1   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_T7   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_T73   450   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   499
YIL036W_UWOPS05_217_3   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_VL3   143   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   192
YIL036W_Vin13   450   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   499
YIL036W_W303   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_X2180-1A   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_Y55   450   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   499
YIL036W_YJM269   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_YJM339   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_YJM789   450   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   499
YIL036W_YPS128   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_YPS163   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
YIL036W_ZTW1   449   AQLQLQKEFNEIKDENRILLKKLNYYEKLISKFKKFSKIHLREHEKLNKD   498
         

YIL036W_S288C   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_AWRI796   183   NDSTTAPTNASNIANTASVNKQMYFMNMNMNNNPHALNDPSIXGNIIAYF   232
YIL036W_CBS7960   447   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   496
YIL036W_CLIB215   500   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   549
YIL036W_DBVPG6044   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_EC1118   500   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   549
YIL036W_EC9-8   500   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   549
YIL036W_FL100   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_FY1679   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_FostersB   183   NDSTTAPTNASNIANTASVNKQMYFMNMNMNNNPHALNDPSILETLSPFF   232
YIL036W_FostersO   183   NDSTTAPTNASNIANTASVNKQMYFMNMNMNNNPHALNDPSILETLSPFF   232
YIL036W_JAY291   500   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   549
YIL036W_JK9-3d   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_K11   499   SDNNVNGTNSSNKNESMTVDSLKVIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_Kyokai7   499   SDNNVNGTNSSNKNESMTVDSLKVIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_LalvinQA23   207   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   256
YIL036W_PW5   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_RedStar   362   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   411
YIL036W_SEY6210   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_SK1   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_T7   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_T73   500   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   549
YIL036W_UWOPS05_217_3   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_VL3   193   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   242
YIL036W_Vin13   500   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   549
YIL036W_W303   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_X2180-1A   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_Y55   500   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   549
YIL036W_YJM269   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_YJM339   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_YJM789   500   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   549
YIL036W_YPS128   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_YPS163   499   SDNNVNGTNSSNKNESMTVDSLKIIEELLMIDSDVTEVDKDTGKIIAIKH   548
YIL036W_ZTW1   499   SDNNVNGTNSSNKNESMTVDSLKVIEELLMIDSDVTEVDKDTGKIIAIKH   548
         

YIL036W_S288C   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_AWRI796   233   FNLLVLM-------------------------------------------   239
YIL036W_CBS7960   497   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   535
YIL036W_CLIB215   550   EPYSQRLGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   588
YIL036W_DBVPG6044   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_EC1118   550   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   588
YIL036W_EC9-8   550   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   588
YIL036W_FL100   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_FY1679   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_FostersB   233   QPFGVDVAHLPMTNPPIFQSSLPGCDEPIRRRRISISNGQISQLGEDIET   282
YIL036W_FostersO   233   QPFGVDVAHLPMTNPPIFQSSLPGCDEPIRRRRISISNGQISQLGEDIET   282
YIL036W_JAY291   550   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   588
YIL036W_JK9-3d   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_K11   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_Kyokai7   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_LalvinQA23   257   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   295
YIL036W_PW5   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_RedStar   412   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   450
YIL036W_SEY6210   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_SK1   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_T7   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_T73   550   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLAQF---------------   584
YIL036W_UWOPS05_217_3   549   EPYSQRFGSDTDDDDIDLKPVESGKDPDNQSLPNSEKIK-----------   587
YIL036W_VL3   243   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   281
YIL036W_Vin13   550   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   588
YIL036W_W303   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_X2180-1A   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_Y55   550   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   588
YIL036W_YJM269   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_YJM339   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_YJM789   550   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   588
YIL036W_YPS128   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_YPS163   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
YIL036W_ZTW1   549   EPYSQRFGSDTDDDDIDLKPVEGGKDPDNQSLPNSEKIK-----------   587
         

YIL036W_S288C   
   --------------------------------------------------   
YIL036W_AWRI796   
   --------------------------------------------------   
YIL036W_CBS7960   
   --------------------------------------------------   
YIL036W_CLIB215   
   --------------------------------------------------   
YIL036W_DBVPG6044   
   --------------------------------------------------   
YIL036W_EC1118   
   --------------------------------------------------   
YIL036W_EC9-8   
   --------------------------------------------------   
YIL036W_FL100   
   --------------------------------------------------   
YIL036W_FY1679   
   --------------------------------------------------   
YIL036W_FostersB   283   LENLHNTQPPPMPNFHNYNGLSQTRNVSNKPVFNQAVPVSSIPQYNDKKS   332
YIL036W_FostersO   283   LENLHNTQPPPMPNFHNYNGLSQTRNVSNKPVFNQAVPVSSIPQYNDKKS   332
YIL036W_JAY291   
   --------------------------------------------------   
YIL036W_JK9-3d   
   --------------------------------------------------   
YIL036W_K11   
   --------------------------------------------------   
YIL036W_Kyokai7   
   --------------------------------------------------   
YIL036W_LalvinQA23   
   --------------------------------------------------   
YIL036W_PW5   
   --------------------------------------------------   
YIL036W_RedStar   
   --------------------------------------------------   
YIL036W_SEY6210   
   --------------------------------------------------   
YIL036W_SK1   
   --------------------------------------------------   
YIL036W_T7   
   --------------------------------------------------   
YIL036W_T73   
   --------------------------------------------------   
YIL036W_UWOPS05_217_3   
   --------------------------------------------------   
YIL036W_VL3   
   --------------------------------------------------   
YIL036W_Vin13   
   --------------------------------------------------   
YIL036W_W303   
   --------------------------------------------------   
YIL036W_X2180-1A   
   --------------------------------------------------   
YIL036W_Y55   
   --------------------------------------------------   
YIL036W_YJM269   
   --------------------------------------------------   
YIL036W_YJM339   
   --------------------------------------------------   
YIL036W_YJM789   
   --------------------------------------------------   
YIL036W_YPS128   
   --------------------------------------------------   
YIL036W_YPS163   
   --------------------------------------------------   
YIL036W_ZTW1   
   --------------------------------------------------   
         

YIL036W_S288C   
   -   
YIL036W_AWRI796   
   -   
YIL036W_CBS7960   
   -   
YIL036W_CLIB215   
   -   
YIL036W_DBVPG6044   
   -   
YIL036W_EC1118   
   -   
YIL036W_EC9-8   
   -   
YIL036W_FL100   
   -   
YIL036W_FY1679   
   -   
YIL036W_FostersB   333   Y   333
YIL036W_FostersO   333   Y   333
YIL036W_JAY291   
   -   
YIL036W_JK9-3d   
   -   
YIL036W_K11   
   -   
YIL036W_Kyokai7   
   -   
YIL036W_LalvinQA23   
   -   
YIL036W_PW5   
   -   
YIL036W_RedStar   
   -   
YIL036W_SEY6210   
   -   
YIL036W_SK1   
   -   
YIL036W_T7   
   -   
YIL036W_T73   
   -   
YIL036W_UWOPS05_217_3   
   -   
YIL036W_VL3   
   -   
YIL036W_Vin13   
   -   
YIL036W_W303   
   -   
YIL036W_X2180-1A   
   -   
YIL036W_Y55   
   -   
YIL036W_YJM269   
   -   
YIL036W_YJM339   
   -   
YIL036W_YJM789   
   -   
YIL036W_YPS128   
   -   
YIL036W_YPS163   
   -   
YIL036W_ZTW1   
   -   
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YIL036W_S288C from SGD:

YIL036W_S288C [source=SGD]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1090  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSV SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TGGENRGKSA LRESHSNPSF

     401  TPKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_AWRI796 from AWRI:

YIL036W_AWRI796 [source=AWRI]  Length: 240  Wed Dec 13 06:51:28 2017  Type: P  Check: 5899  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSIXGNIIA YFFNLLVLM*

Protein Sequence for YIL036W_CBS7960 from WashU:

YIL036W_CBS7960 [source=WashU]  Length: 536  Wed Dec 13 06:51:28 2017  Type: P  Check: 1484  ..

       1  MNNSALSRSL DPTDINYNTN MAGVVDQIHD YTTSNRNSLT PQYSIAAGNV

      51  NSHDRVVKPS ANSNYQQAAY LRQQQQQDQR QQSPSMKTEE ESQLYGDILM

     101  NPGVVQDMHQ NLAPSYNLSQ LSSTRKSAPN DSTTAPTNAS NIANTASVNK

     151  QMYFMNMNMN NNPHALNDPS ILETLSPFFQ PFGVDVAHLP MTNPPIFQSS

     201  LPGCDEPIRR RRISISNGQI SQLGEDIETL ENLHNTQPPP MPNFHNYNGL

     251  SQTRNVSNKP VFNQAVPVSS IPQYNAKKVI NPTKDSALGD QSVIYSKSQQ

     301  RNFVNAPSKN TPAESISDLE GMTTFAPTTG GENRGKSALR ESHSNPSFTP

     351  KSQGSHLNLA ANTQGNPIPG TTAWKRARLL ERNRIAASKC RQRKKVAQLQ

     401  LQKEFNEIKD ENRILLKKLN YYEKLISKFK KFSKIHLREH EKLNKDSDNN

     451  VNGTNSSNKN ESMTVDSLKI IEELLMIDSD VTEVDKDTGK IIAIKHEPYS

     501  QRFGSDTDDD DIDLKPVEGG KDPDNQSLPN SEKIK*

Protein Sequence for YIL036W_CLIB215 from WashU:

YIL036W_CLIB215 [source=WashU]  Length: 589  Wed Dec 13 06:51:28 2017  Type: P  Check: 1975  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNAK KVINPTKDSA LGDQSVIYSK

     351  SQQRNFVNAP SKNTPAESIS DLEGMTTFAP TTGGENRGKS ALRESHSNPS

     401  FTSKSQGSHL NLAANTQGNP IPGTTAWKKA RLLERNRIAA SKCRQRKKVA

     451  QLQLQKEFNE IKDENRILLK KLNYYEKLIS KFKKFSKIHL REHEKLNKDS

     501  DNNVNGTNSS NKNESMTVDS LKIIEELLMI DSDVTEVDKD TGKIIAIKHE

     551  PYSQRLGSDT DDDDIDLKPV EGGKDPDNQS LPNSEKIK*

Protein Sequence for YIL036W_DBVPG6044 from Stanford:

YIL036W_DBVPG6044 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 526  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVGVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_EC1118 from Genoscope:

YIL036W_EC1118 [source=Genoscope]  Length: 589  Wed Dec 13 06:51:28 2017  Type: P  Check: 2115  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNAK KVINPTKDSA LGDQSVIYSK

     351  SQQRNFVNAP SKNTPAESIS DLEGMTTFAP TTGGENRGKS APRESHSNPS

     401  FTPKSQGSHL NLAANTQGNP IPGTTAWKRA RLLERNRIAA SKCRQRKKVA

     451  QLQLQKEFNE IKDENRILLK KLNYYEKLIS KFKKFSKIHL REHEKLNKDS

     501  DNNVNGTNSS NKNESMTVDS LKIIEELLMI DSDVTEVDKD TGKIIAIKHE

     551  PYSQRFGSDT DDDDIDLKPV EGGKDPDNQS LPNSEKIK*

Protein Sequence for YIL036W_EC9-8 from ASinica:

YIL036W_EC9-8 [source=ASinica]  Length: 589  Wed Dec 13 06:51:28 2017  Type: P  Check: 1935  ..

       1  MFTGQEDHSV DSNSTKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNSSVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLLP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNAK KVINPTKDSA LGDQSVIYSK

     351  SQQRNFVNAP SKNTPAESIS DLEGMTTFAP TTGGENRGKS ALRESHSNPS

     401  FTPKSQGSHL NLAANTQGNP IPGTTAWKRA RLLERNRIAA SKCRQRKKVA

     451  HLQLQKEFNE IKDENRILLK KLNYYEKLIS KFKKFSKIHL REHEKLNKDS

     501  DNNVNGTNSS NKNESMTVDS LKIIEELLMI DSDVTEVDKD TGKIIAIKHE

     551  PYSQRFGSDT DDDDIDLKPV EGGKDPDNQS LPNSEKIK*

Protein Sequence for YIL036W_FL100 from Stanford:

YIL036W_FL100 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1293  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYDDI

     151  LMNPGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSTL GDQNVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_FY1679 from Stanford:

YIL036W_FY1679 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1090  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSV SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TGGENRGKSA LRESHSNPSF

     401  TPKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_FostersB from AWRI:

YIL036W_FostersB [source=AWRI]  Length: 334  Wed Dec 13 06:51:28 2017  Type: P  Check: 1363  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNDK KSY*

Protein Sequence for YIL036W_FostersO from AWRI:

YIL036W_FostersO [source=AWRI]  Length: 334  Wed Dec 13 06:51:28 2017  Type: P  Check: 1363  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNDK KSY*

Protein Sequence for YIL036W_JAY291 from Duke:

YIL036W_JAY291 [source=Duke]  Length: 589  Wed Dec 13 06:51:28 2017  Type: P  Check: 1891  ..

       1  MFTGQEDHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNSGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNAK KVINPTKDSA LGDQSVIYSK

     351  SQQRNFVNAP SKNTPAESIS DLEGMTTFAP TTGGENRGKS ALRESHSNPS

     401  FTPKSQGSHL NLAANTQGNP IPGTTAWKRA RLLERNRIAA SKCRQRKKVA

     451  QLQLQKEFNE IKDENRILLK KLNYYEKLIS KFKKFSKIHL REHEKLNKDS

     501  DNNVNGTNSS NKNESMTVDS LKIIEELLMI DSDVTEVDKD TGKIIAIKHE

     551  PYSQRFGSDT DDDDIDLKPV EGGKDPDNQS LPNSEKIK*

Protein Sequence for YIL036W_JK9-3d from Stanford:

YIL036W_JK9-3d [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1293  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYDDI

     151  LMNPGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSTL GDQNVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_K11 from Stanford:

YIL036W_K11 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1530  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYDDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSTL GDQNVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KVIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_Kyokai7 from NRIB:

YIL036W_Kyokai7 [source=NRIB]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1338  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAPTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYDDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSTL GDQNVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KVIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_LalvinQA23 from AWRI:

YIL036W_LalvinQA23 [source=AWRI]  Length: 296  Wed Dec 13 06:51:28 2017  Type: P  Check: 6264  ..

       1  MPNFHNYNGL SQTRNVSNKP VFNQAVPVSS IPQYNAKKVI NPTKDSALGD

      51  QSVIYSKSQQ RNFVNAPSKN TPAESISDLE GMTTFAPTTG GENRGKSAXR

     101  ESHSNPSFTP KSQGSHLNLA ANTQGNPIPG TTAWKRARLL ERNRIAASKC

     151  RQRKKVAQLQ LQKEFNEIKD ENRILLKKLN YYEKLISKFK KFSKIHLREH

     201  EKLNKDSDNN VNGTNSSNKN ESMTVDSLKI IEELLMIDSD VTEVDKDTGK

     251  IIAIKHEPYS QRFGSDTDDD DIDLKPVEGG KDPDNQSLPN SEKIK*


Protein Sequence for YIL036W_PW5 from WashU:

YIL036W_PW5 [source=WashU]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 499  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_RedStar from Stanford:

YIL036W_RedStar [source=Stanford]  Length: 451  Wed Dec 13 06:51:28 2017  Type: P  Check: 4325  ..

       1  MKTEEESQLY GDILMNPGVV QDMHQNLATH TNLSQLSYTR KSAPNDSTTA

      51  PTNASNIANT ASVNKQMYFM NMNMNNNPHA LNDPSILETL SPFFQPFGVD

     101  VAHLPMTNPP IFQSSLPGCD EPIRRRRISI SNGQISQLGE DIETLENLHN

     151  TQPPPMPNFH NYNGLSQTRN VSNKPVFNQA VPVSSIPQYN AKKVINPTKD

     201  STLGDQNVIY SKSQQRNFVN APSKNTPAES ISDLEGMTTF APTTEGENRG

     251  KSALRESHSN PSFTSKSQGS HLNLAANTQG NPIPGTTAWK RARLLERNRI

     301  AASKCRQRKK VAQLQLQKEF NEIKDENRIL LKKLNYYEKL ISKFKKFSKI

     351  HLREHEKLNK DSDNNVNGTN SSNKNESMTV DSLKIIEELL MIDSDVTEVD

     401  KDTGKIIAIK HEPYSQRFGS DTDDDDIDLK PVEGGKDPDN QSLPNSEKIK

     451  *

Protein Sequence for YIL036W_SEY6210 from Stanford:

YIL036W_SEY6210 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1090  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSV SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TGGENRGKSA LRESHSNPSF

     401  TPKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_SK1 from Stanford:

YIL036W_SK1 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 396  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDQVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYDDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQPNFVNAPS KNTPAESISD LEGMTTFAPT TGGENRGKSA LRESHSNPSF

     401  TPKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_T7 from WashU:

YIL036W_T7 [source=WashU]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 499  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_T73 from WashU:

YIL036W_T73 [source=WashU]  Length: 585  Wed Dec 13 06:51:28 2017  Type: P  Check: 6286  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNAK KVINPTEDSA LGDQSVIYSK

     351  SQQRNFVNAP SKNTPAESIS DLEGMTTFAP TTGGENRGKS ALRESHSNPS

     401  FTPKSQGSHL NLAANTQGNP IPGTTAWKRA RLLERNRIAA SKCRQRKKVA

     451  QLQLQKEFNE IKDENRILLK KLNYYEKLIS KFKKFSKIHL REHEKLNKDS

     501  DNNVNGTNSS NKNESMTVDS LKIIEELLMI DSDVTEVDKD TGKIIAIKHE

     551  PYSQRFGSDT DDDDIDLKPV EGGKDPDNQS LAQF*

Protein Sequence for YIL036W_UWOPS05_217_3 from Stanford:

YIL036W_UWOPS05_217_3 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 551  ..

       1  MFTGQEYHSV DSNSTKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQNVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TDGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE SGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_VL3 from AWRI:

YIL036W_VL3 [source=AWRI]  Length: 282  Wed Dec 13 06:51:28 2017  Type: P  Check: 8034  ..

       1  MYQTSRSSTK QCRLVVFHNT MTKKVINPTK DSALGDQSVI YSKSQQRNFV

      51  NAPSKNTPAE SISDLEGMTT FAPTTGGENR GKSALRESHS NPSFTPKSQG

     101  SHLNLAANTQ GNPIPGTTAW KRARLLERNR IAASKCRQRK KVAQLQLQKE

     151  FNEIKDENRI LLKKLNYYEK LISKFKKFSK IHLREHEKLN KDSDNNVNGT

     201  NSSNKNESMT VDSLKIIEEL LMIDSDVTEV DKDTGKIIAI KHEPYSQRFG

     251  SDTDDDDIDL KPVEGGKDPD NQSLPNSEKI K*

Protein Sequence for YIL036W_Vin13 from AWRI:

YIL036W_Vin13 [source=AWRI]  Length: 589  Wed Dec 13 06:51:28 2017  Type: P  Check: 1915  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNAK KVINPTKDSA LGDQSVIYSK

     351  SQQRNFVNAP SKNTPAESIS DLEGMTTFAP TTGGENRGKS ALRESHSNPS

     401  FTPKSQGSHL NLAANTQGNP IPGTTAWKRA RLLERNRIAA SKCRQRKKVA

     451  QLQLQKEFNE IKDENRILLK KLNYYEKLIS KFKKFSKIHL REHEKLNKDS

     501  DNNVNGTNSS NKNESMTVDS LKIIEELLMI DSDVTEVDKD TGKIIAIKHE

     551  PYSQRFGSDT DDDDIDLKPV EGGKDPDNQS LPNSEKIK*

Protein Sequence for YIL036W_W303 from Stanford:

YIL036W_W303 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1090  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSV SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TGGENRGKSA LRESHSNPSF

     401  TPKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_X2180-1A from Stanford:

YIL036W_X2180-1A [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1090  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSV SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TGGENRGKSA LRESHSNPSF

     401  TPKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_Y55 from Stanford:

YIL036W_Y55 [source=Stanford]  Length: 589  Wed Dec 13 06:51:28 2017  Type: P  Check: 1915  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNAK KVINPTKDSA LGDQSVIYSK

     351  SQQRNFVNAP SKNTPAESIS DLEGMTTFAP TTGGENRGKS ALRESHSNPS

     401  FTPKSQGSHL NLAANTQGNP IPGTTAWKRA RLLERNRIAA SKCRQRKKVA

     451  QLQLQKEFNE IKDENRILLK KLNYYEKLIS KFKKFSKIHL REHEKLNKDS

     501  DNNVNGTNSS NKNESMTVDS LKIIEELLMI DSDVTEVDKD TGKIIAIKHE

     551  PYSQRFGSDT DDDDIDLKPV EGGKDPDNQS LPNSEKIK*

Protein Sequence for YIL036W_YJM269 from WashU:

YIL036W_YJM269 [source=WashU]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 589  ..

       1  MFTGQEYHSV DSNSTKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_YJM339 from Stanford:

YIL036W_YJM339 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 229  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL NQLSSSRKSA SNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQNVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_YJM789 from Stanford:

YIL036W_YJM789 [source=Stanford]  Length: 589  Wed Dec 13 06:51:28 2017  Type: P  Check: 1915  ..

       1  MFTGQEYHSV DSNSSKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAAAAT

      51  TSTMNNSALS RSLDPTDINY NTNMAGVVDQ IHDYTTSNRN SLTPQYSIAA

     101  GNVNSHDRVV KPSANSNYQQ AAYLRQQQQQ DQRQQSPSMK TEEESQLYGD

     151  ILMNPGVVQD MHQNLATHTN LSQLSSTRKS APNDSTTAPT NASNIANTAS

     201  VNKQMYFMNM NMNNNPHALN DPSILETLSP FFQPFGVDVA HLPMTNPPIF

     251  QSSLPGCDEP IRRRRISISN GQISQLGEDI ETLENLHNTQ PPPMPNFHNY

     301  NGLSQTRNVS NKPVFNQAVP VSSIPQYNAK KVINPTKDSA LGDQSVIYSK

     351  SQQRNFVNAP SKNTPAESIS DLEGMTTFAP TTGGENRGKS ALRESHSNPS

     401  FTPKSQGSHL NLAANTQGNP IPGTTAWKRA RLLERNRIAA SKCRQRKKVA

     451  QLQLQKEFNE IKDENRILLK KLNYYEKLIS KFKKFSKIHL REHEKLNKDS

     501  DNNVNGTNSS NKNESMTVDS LKIIEELLMI DSDVTEVDKD TGKIIAIKHE

     551  PYSQRFGSDT DDDDIDLKPV EGGKDPDNQS LPNSEKIK*

Protein Sequence for YIL036W_YPS128 from Stanford:

YIL036W_YPS128 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 364  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTKAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_YPS163 from Stanford:

YIL036W_YPS163 [source=Stanford]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 364  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYGDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTKAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSAL GDQSVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KIIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*

Protein Sequence for YIL036W_ZTW1 from Zhejiang:

YIL036W_ZTW1 [source=Zhejiang]  Length: 588  Wed Dec 13 06:51:28 2017  Type: P  Check: 1530  ..

       1  MFTGQEYHSV DSNSNKQKDN NKRGIDDTSK ILNNKIPHSI SDTSAAATTT

      51  STMNNSALSR SLDPTDINYS TNMAGVVDQI HDYTTSNRNS LTPQYSIAAG

     101  NVNSHDRVVK PSANSNYQQA AYLRQQQQQD QRQQSPSMKT EEESQLYDDI

     151  LMNSGVVQDM HQNLATHTNL SQLSSTRKSA PNDSTTAPTN ASNIANTASV

     201  NKQMYFMNMN MNNNPHALND PSILETLSPF FQPFGVDVAH LPMTNPPIFQ

     251  SSLPGCDEPI RRRRISISNG QISQLGEDIE TLENLHNTQP PPMPNFHNYN

     301  GLSQTRNVSN KPVFNQAVPV SSIPQYNAKK VINPTKDSTL GDQNVIYSKS

     351  QQRNFVNAPS KNTPAESISD LEGMTTFAPT TEGENRGKSA LRESHSNPSF

     401  TSKSQGSHLN LAANTQGNPI PGTTAWKRAR LLERNRIAAS KCRQRKKVAQ

     451  LQLQKEFNEI KDENRILLKK LNYYEKLISK FKKFSKIHLR EHEKLNKDSD

     501  NNVNGTNSSN KNESMTVDSL KVIEELLMID SDVTEVDKDT GKIIAIKHEP

     551  YSQRFGSDTD DDDIDLKPVE GGKDPDNQSL PNSEKIK*