YHR214C-E S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YHR214C-E_S288C   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_AWRI1631   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_AWRI796   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_CBS7960   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_CLIB324   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_CLIB382   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_EC1118   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_EC9-8   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_FostersB   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_FostersO   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_JAY291   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_LalvinQA23   1   --------MWPQYGSHLQHGRG------------CPKTKPHHLWQHLRET   30
YHR214C-E_M22   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_T73   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQNKLGLQDILDFF   50
YHR214C-E_VL3   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLIRFFQCRLQKQARFARYPGLF   50
YHR214C-E_YJM789   1   MYKITTIYLWLKSYLSFFIGLDNLDFLTLTRFFQCRLQNKLGLQDILDFF   50
         

YHR214C-E_S288C   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_AWRI1631   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_AWRI796   51   CNLCGHSMVRTCNMVEADPKTKPHHLWQHLRETPSSCQTLHRNRVGPTSV   100
YHR214C-E_CBS7960   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_CLIB324   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_CLIB382   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_EC1118   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_EC9-8   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_FostersB   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_FostersO   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_JAY291   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_LalvinQA23   31   PSSCQTLHRNRVGPTSVNQ-------------------------------   49
YHR214C-E_M22   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_T73   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
YHR214C-E_VL3   51   FVIYVATVWFALATW-----------------------------------   65
YHR214C-E_YJM789   51   CNLCGHSMVRTCNMVEAAQKQNRITFGSIYVKLHPLVKLCTGIVWAPRV-   99
         

YHR214C-E_S288C   
   --   
YHR214C-E_AWRI1631   
   --   
YHR214C-E_AWRI796   101   NQ   102
YHR214C-E_CBS7960   
   --   
YHR214C-E_CLIB324   
   --   
YHR214C-E_CLIB382   
   --   
YHR214C-E_EC1118   
   --   
YHR214C-E_EC9-8   
   --   
YHR214C-E_FostersB   
   --   
YHR214C-E_FostersO   
   --   
YHR214C-E_JAY291   
   --   
YHR214C-E_LalvinQA23   
   --   
YHR214C-E_M22   
   --   
YHR214C-E_T73   
   --   
YHR214C-E_VL3   
   --   
YHR214C-E_YJM789   
   --   
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YHR214C-E_S288C from SGD:

YHR214C-E_S288C [source=SGD]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_AWRI1631 from AWRI:

YHR214C-E_AWRI1631 [source=AWRI]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_AWRI796 from AWRI:

YHR214C-E_AWRI796 [source=AWRI]  Length: 103  Wed Nov 22 14:17:44 2017  Type: P  Check: 6915  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEADPK TKPHHLWQHL RETPSSCQTL HRNRVGPTSV

     101  NQ*

Protein Sequence for YHR214C-E_CBS7960 from WashU:

YHR214C-E_CBS7960 [source=WashU]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_CLIB324 from WashU:

YHR214C-E_CLIB324 [source=WashU]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_CLIB382 from WashU:

YHR214C-E_CLIB382 [source=WashU]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_EC1118 from Genoscope:

YHR214C-E_EC1118 [source=Genoscope]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_EC9-8 from ASinica:

YHR214C-E_EC9-8 [source=ASinica]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_FostersB from AWRI:

YHR214C-E_FostersB [source=AWRI]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_FostersO from AWRI:

YHR214C-E_FostersO [source=AWRI]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_JAY291 from Duke:

YHR214C-E_JAY291 [source=Duke]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_LalvinQA23 from AWRI:

YHR214C-E_LalvinQA23 [source=AWRI]  Length: 50  Wed Nov 22 14:17:44 2017  Type: P  Check: 8714  ..

       1  MWPQYGSHLQ HGRGCPKTKP HHLWQHLRET PSSCQTLHRN RVGPTSVNQ*


Protein Sequence for YHR214C-E_M22 from WashU:

YHR214C-E_M22 [source=WashU]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_T73 from WashU:

YHR214C-E_T73 [source=WashU]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5395  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*


Protein Sequence for YHR214C-E_VL3 from AWRI:

YHR214C-E_VL3 [source=AWRI]  Length: 66  Wed Nov 22 14:17:44 2017  Type: P  Check: 9677  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLI RFFQCRLQKQ ARFARYPGLF

      51  FVIYVATVWF ALATW*

Protein Sequence for YHR214C-E_YJM789 from Stanford:

YHR214C-E_YJM789 [source=Stanford]  Length: 100  Wed Nov 22 14:17:44 2017  Type: P  Check: 5725  ..

       1  MYKITTIYLW LKSYLSFFIG LDNLDFLTLT RFFQCRLQNK LGLQDILDFF

      51  CNLCGHSMVR TCNMVEAAQK QNRITFGSIY VKLHPLVKLC TGIVWAPRV*