KOG1/YHR186C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YHR186C_S288C   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_AWRI796   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_BY4741   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_BY4742   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_CEN.PK   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_D273-10B   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_DBVPG6044   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_EC1118   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLGNDFIFYFDDKRHKTN   50
YHR186C_EC9-8   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_FL100   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_FY1679   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_FostersB   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_FostersO   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_JAY291   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_JK9-3d   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_Kyokai7   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_LalvinQA23   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLGNDFIFYFDDKRHKTN   50
YHR186C_RM11-1a   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_RedStar   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_SEY6210   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_SK1   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_T7   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_T73   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_UC5   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_UWOPS05_217_3   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_VL3   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_Vin13   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLXNDFIFYFDDKRHKTN   50
YHR186C_W303   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_X2180-1A   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_Y55   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_YJM339   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_YJM789   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_YPH499   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
YHR186C_ZTW1   1   MPEIYGPQPLKPLNTVMRHGFEEQYQSDQLLQSLANDFIFYFDDKRHKTN   50
         

YHR186C_S288C   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_AWRI796   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_BY4741   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_BY4742   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_CEN.PK   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_D273-10B   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_DBVPG6044   51   GNPIPEEDKQRDVNCYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_EC1118   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_EC9-8   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_FL100   51   GNPIPEEDKQQDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_FY1679   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_FostersB   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAXLLLCLNLGVDPPDV   100
YHR186C_FostersO   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_JAY291   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_JK9-3d   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_Kyokai7   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_LalvinQA23   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_RM11-1a   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_RedStar   51   GNPIPEEDKQQDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_SEY6210   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_SK1   51   GNPIPEEDKQRDVNCYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_T7   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_T73   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_UC5   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_UWOPS05_217_3   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_VL3   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_Vin13   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_W303   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_X2180-1A   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_Y55   51   GNPIPEEDKQRDVNCYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_YJM339   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_YJM789   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_YPH499   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
YHR186C_ZTW1   51   GNPIPEEDKQRDVNRYYQPITDWKIMKDRQKTVSAALLLCLNLGVDPPDV   100
         

YHR186C_S288C   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_AWRI796   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_BY4741   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_BY4742   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_CEN.PK   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_D273-10B   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_DBVPG6044   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_EC1118   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_EC9-8   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_FL100   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_FY1679   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_FostersB   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQTQYETLSLRTRYKQSLD   150
YHR186C_FostersO   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_JAY291   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_JK9-3d   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_Kyokai7   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_LalvinQA23   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_RM11-1a   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_RedStar   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_SEY6210   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_SK1   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_T7   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_T73   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_UC5   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_UWOPS05_217_3   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_VL3   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_Vin13   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_W303   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_X2180-1A   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_Y55   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_YJM339   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_YJM789   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_YPH499   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
YHR186C_ZTW1   101   MKTHPCARVEAWVDPLNFQDSKKAIEQIGKNLQAQYETLSLRTRYKQSLD   150
         

YHR186C_S288C   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_AWRI796   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_BY4741   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_BY4742   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_CEN.PK   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_D273-10B   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_DBVPG6044   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_EC1118   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_EC9-8   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_FL100   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_FY1679   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_FostersB   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_FostersO   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_JAY291   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_JK9-3d   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_Kyokai7   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFKRGYTQY   200
YHR186C_LalvinQA23   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_RM11-1a   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_RedStar   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_SEY6210   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_SK1   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_T7   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_T73   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_UC5   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_UWOPS05_217_3   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_VL3   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_Vin13   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_W303   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_X2180-1A   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_Y55   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_YJM339   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_YJM789   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_YPH499   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
YHR186C_ZTW1   151   PCVEDVKRFCNSLRRTSKEDRILFHYNGHGVPKPTKSGEIWVFNRGYTQY   200
         

YHR186C_S288C   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_AWRI796   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_BY4741   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_BY4742   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_CEN.PK   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_D273-10B   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_DBVPG6044   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_EC1118   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_EC9-8   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_FL100   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_FY1679   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_FostersB   201   IPVSLYDLQTWLGAPCIFVYDCNSAGNILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_FostersO   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_JAY291   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_JK9-3d   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_Kyokai7   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_LalvinQA23   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_RM11-1a   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_RedStar   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_SEY6210   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_SK1   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_T7   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_T73   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_UC5   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_UWOPS05_217_3   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_VL3   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_Vin13   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_W303   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_X2180-1A   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_Y55   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_YJM339   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_YJM789   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_YPH499   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
YHR186C_ZTW1   201   IPVSLYDLQTWLGAPCIFVYDCNSAENILINFQKFVQKRIKDDEEGNHDV   250
         

YHR186C_S288C   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_AWRI796   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_BY4741   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_BY4742   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_CEN.PK   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_D273-10B   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_DBVPG6044   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_EC1118   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_EC9-8   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_FL100   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_FY1679   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_FostersB   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCXIEISIRIF   300
YHR186C_FostersO   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_JAY291   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_JK9-3d   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_Kyokai7   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_LalvinQA23   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_RM11-1a   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_RedStar   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_SEY6210   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_SK1   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_T7   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_T73   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_UC5   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_UWOPS05_217_3   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_VL3   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_Vin13   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_W303   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_X2180-1A   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_Y55   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_YJM339   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_YJM789   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_YPH499   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
YHR186C_ZTW1   251   AAPSPTSAYQDCFQLASCTSDELLLMSPELPADLFSCCLTCPIEISIRIF   300
         

YHR186C_S288C   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_AWRI796   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_BY4741   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_BY4742   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_CEN.PK   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_D273-10B   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_DBVPG6044   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_EC1118   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_EC9-8   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_FL100   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_FY1679   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_FostersB   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_FostersO   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_JAY291   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_JK9-3d   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_Kyokai7   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_LalvinQA23   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_RM11-1a   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_RedStar   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_SEY6210   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_SK1   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_T7   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKCKIPNVNIPGMLSDRRTP   350
YHR186C_T73   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_UC5   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_UWOPS05_217_3   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_VL3   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_Vin13   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_W303   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_X2180-1A   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_Y55   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_YJM339   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_YJM789   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_YPH499   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
YHR186C_ZTW1   301   LMQSPLKDSKYKIFFENSTSNQPFGDSKNSFKSKIPNVNIPGMLSDRRTP   350
         

YHR186C_S288C   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_AWRI796   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_BY4741   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_BY4742   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_CEN.PK   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_D273-10B   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_DBVPG6044   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_EC1118   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_EC9-8   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_FL100   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_FY1679   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_FostersB   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_FostersO   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_JAY291   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_JK9-3d   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_Kyokai7   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_LalvinQA23   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_RM11-1a   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_RedStar   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_SEY6210   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_SK1   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_T7   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_T73   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_UC5   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_UWOPS05_217_3   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_VL3   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_Vin13   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_W303   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_X2180-1A   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_Y55   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_YJM339   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_YJM789   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_YPH499   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
YHR186C_ZTW1   351   LGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMIAALFRNFLLAKRIMP   400
         

YHR186C_S288C   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_AWRI796   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_BY4741   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_BY4742   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_CEN.PK   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_D273-10B   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_DBVPG6044   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_EC1118   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_EC9-8   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIIIDLKNAPPATALE   450
YHR186C_FL100   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_FY1679   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_FostersB   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_FostersO   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_JAY291   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVTDLKNAPPATALE   450
YHR186C_JK9-3d   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_Kyokai7   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_LalvinQA23   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_RM11-1a   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_RedStar   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_SEY6210   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_SK1   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_T7   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_T73   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_UC5   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_UWOPS05_217_3   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_VL3   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_Vin13   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_W303   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_X2180-1A   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_Y55   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_YJM339   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_YJM789   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_YPH499   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
YHR186C_ZTW1   401   WYNCHPVSDPELPDSITTHPMWKSWDLAMDEVLTKIVIDLKNAPPATALE   450
         

YHR186C_S288C   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_AWRI796   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_BY4741   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_BY4742   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_CEN.PK   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_D273-10B   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_DBVPG6044   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_EC1118   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_EC9-8   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_FL100   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_FY1679   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_FostersB   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_FostersO   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_JAY291   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_JK9-3d   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_Kyokai7   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_LalvinQA23   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_RM11-1a   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVASLSTMSLVNNPA   500
YHR186C_RedStar   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_SEY6210   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_SK1   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_T7   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_T73   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_UC5   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_UWOPS05_217_3   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_VL3   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_Vin13   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_W303   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_X2180-1A   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_Y55   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_YJM339   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_YJM789   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_YPH499   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
YHR186C_ZTW1   451   SQMILQQQETLQNGGSSKSNAQDTKAGSIQTQSRFAVANLSTMSLVNNPA   500
         

YHR186C_S288C   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_AWRI796   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_BY4741   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_BY4742   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_CEN.PK   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_D273-10B   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_DBVPG6044   501   LQSRKSISLQSSQQQLQQQQQQQQQQ-FTGFFEQNLTAFELWLKYASNVR   549
YHR186C_EC1118   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_EC9-8   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_FL100   501   LQSRNSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_FY1679   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_FostersB   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_FostersO   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_JAY291   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_JK9-3d   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_Kyokai7   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_LalvinQA23   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_RM11-1a   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_RedStar   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_SEY6210   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_SK1   501   LQSRKSISLQSSQQQLQQQQQQQQQQ-FTGFFEQNLTAFELWLKYASNVR   549
YHR186C_T7   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_T73   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_UC5   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_UWOPS05_217_3   501   LQSRKSISLQSSQQQLQQQQQQQQQQQFTGFFEQNLTAFELWLKYASNVR   550
YHR186C_VL3   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_Vin13   501   LQSRKSISLQSSQQQLQQQQQQQQQFYRXF--------------------   530
YHR186C_W303   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_X2180-1A   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_Y55   501   LQSRKSISLQSSQQQLQQQQQQQQQQ-FTGFFEQNLTAFELWLKYASNVR   549
YHR186C_YJM339   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_YJM789   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_YPH499   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
YHR186C_ZTW1   501   LQSRKSISLQSSQQQLQQQQQQQQQ--FTGFFEQNLTAFELWLKYASNVR   548
         

YHR186C_S288C   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_AWRI796   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFFRFRPVGCLPVTFNRYLPLRF   598
YHR186C_BY4741   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_BY4742   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_CEN.PK   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_D273-10B   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_DBVPG6044   550   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   599
YHR186C_EC1118   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_EC9-8   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_FL100   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_FY1679   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_FostersB   549   HPPEQLPIVLQVLLSQVHRIRALVLLSXIFRFRPVGCLPVTFNRYLPLRF   598
YHR186C_FostersO   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_JAY291   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_JK9-3d   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_Kyokai7   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_LalvinQA23   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_RM11-1a   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_RedStar   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_SEY6210   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_SK1   550   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   599
YHR186C_T7   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_T73   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_UC5   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_UWOPS05_217_3   551   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   600
YHR186C_VL3   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_Vin13   
   --------------------------------------------------   
YHR186C_W303   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_X2180-1A   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_Y55   550   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   599
YHR186C_YJM339   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_YJM789   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_YPH499   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
YHR186C_ZTW1   549   HPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL   598
         

YHR186C_S288C   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_AWRI796   599   EAATKSST------------------------------------------   606
YHR186C_BY4741   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_BY4742   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_CEN.PK   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_D273-10B   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_DBVPG6044   600   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   649
YHR186C_EC1118   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_EC9-8   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_FL100   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_FY1679   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_FostersB   599   EXXTKSST------------------------------------------   606
YHR186C_FostersO   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_JAY291   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_JK9-3d   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_Kyokai7   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_LalvinQA23   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_RM11-1a   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_RedStar   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_SEY6210   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_SK1   600   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   649
YHR186C_T7   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_T73   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_UC5   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_UWOPS05_217_3   601   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   650
YHR186C_VL3   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_Vin13   
   --------------------------------------------------   
YHR186C_W303   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_X2180-1A   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_Y55   600   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   649
YHR186C_YJM339   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_YJM789   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_YPH499   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
YHR186C_ZTW1   599   KLLQSPAPELKPILVFIWARIMSIDYKNTQSELIKEKGYMYFVTVLVPDW   648
         

YHR186C_S288C   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_AWRI796   
   --------------------------------------------------   
YHR186C_BY4741   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_BY4742   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_CEN.PK   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_D273-10B   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_DBVPG6044   650   GVNSISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   699
YHR186C_EC1118   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQENRTSNLGHN   698
YHR186C_EC9-8   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_FL100   649   GVNGISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_FY1679   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_FostersB   
   --------------------------------------------------   
YHR186C_FostersO   649   GVNGISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_JAY291   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_JK9-3d   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_Kyokai7   649   GVNGISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_LalvinQA23   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQENRTSNLGHN   698
YHR186C_RM11-1a   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_RedStar   649   GVNGISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_SEY6210   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_SK1   650   GVNSISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   699
YHR186C_T7   649   GVNGISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_T73   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_UC5   649   GVNGISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_UWOPS05_217_3   651   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   700
YHR186C_VL3   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_Vin13   
   --------------------------------------------------   
YHR186C_W303   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_X2180-1A   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_Y55   650   GVNSISATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   699
YHR186C_YJM339   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_YJM789   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_YPH499   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
YHR186C_ZTW1   649   GVNGMSATNGSAMINSGNPLTMTASQNINGPSSRYYERQQGNRTSNLGHN   698
         

YHR186C_S288C   699   NLPFYHSNDTTDEQKAMAVFVLASFVRNFPLGQKNCFSLELVNKLCFYID   748
YHR186C_AWRI796   
   --------------------------------------------------   
YHR186C_BY4741   699   NLPFYHSNDTTDEQKAMAVFVLASFVRNFPLGQKNCFSLELVNKLCFYID   748
YHR186C_BY4742   699   NLPFYHSNDTTDEQKAMAVFVLASFVRNFPLGQKNCFSLELVNKLCFYID   748
YHR186C_CEN.PK   699   NLPFYHSNDTTDEQKAMAVFVLASFVRNFPLGQKNCFSLELVNKLCFYID   748
YHR186C_D273-10B   699   NLPF