WSS1/YHR134W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YHR134W_S288C   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_AWRI796   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_BC187   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_BY4741   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_BY4742   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_CEN.PK   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_D273-10B   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_DBVPG6044   1   MKTEGIKSPSAKYHDMAGSQRIAHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_EC1118   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_EC9-8   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_FL100   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_FY1679   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_FostersB   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_FostersO   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_JAY291   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_JK9-3d   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_K11   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_Kyokai7   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_L1528   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_LalvinQA23   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_PW5   1   MKTEGIKSPSAKYHDMAGSLRIAHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_RM11-1a   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_RedStar   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_SEY6210   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_SK1   1   MKTEGIKSPSAKYHDMAGSQRIAHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_T7   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_T73   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_UC5   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_UWOPS05_217_3   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_VL3   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_Vin13   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_W303   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_X2180-1A   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_Y55   1   MKTEGIKSPSAKYHDMAGSQRIAHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_YJM269   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_YJM339   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_YJM789   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_YPH499   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_YPS128   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHVQKVAVLQSKPNKEDALNLIKE   50
YHR134W_YPS163   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHVQKVAVLQSKPNKEDALNLIKE   50
YHR134W_YS9   1   MKTEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
YHR134W_ZTW1   1   MKAEGIKSPSAKYHDMAGSQRIPHKNPHIQKVAVLQSKPNKEDALNLIKE   50
         

YHR134W_S288C   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_AWRI796   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_BC187   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_BY4741   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_BY4742   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_CEN.PK   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_D273-10B   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_DBVPG6044   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNINHGSKIMLRLRCSTDE   100
YHR134W_EC1118   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_EC9-8   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_FL100   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_FY1679   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_FostersB   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_FostersO   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_JAY291   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_JK9-3d   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_K11   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_Kyokai7   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_L1528   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_LalvinQA23   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_PW5   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNINHGSKIMLRLRCSTDE   100
YHR134W_RM11-1a   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_RedStar   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_SEY6210   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_SK1   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNINHGSKIMLRLRCSTDE   100
YHR134W_T7   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNINHGSKIMLRLRCSTDE   100
YHR134W_T73   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_UC5   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_UWOPS05_217_3   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_VL3   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_Vin13   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_W303   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_X2180-1A   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_Y55   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNINHGSKIMLRLRCSTDE   100
YHR134W_YJM269   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_YJM339   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_YJM789   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_YPH499   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_YPS128   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNINHGSKIMLRLRCSTDE   100
YHR134W_YPS163   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNINHGSKIMLRLRCSTDE   100
YHR134W_YS9   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
YHR134W_ZTW1   51   IAHKVSYLMKENHFKVTNLVEFYPRDQRLLGMNVNHGSKIMLRLRCSTDE   100
         

YHR134W_S288C   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_AWRI796   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWIIEQRGLYD   150
YHR134W_BC187   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWIIEQRGLYD   150
YHR134W_BY4741   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_BY4742   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_CEN.PK   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_D273-10B   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_DBVPG6044   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_EC1118   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_EC9-8   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_FL100   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_FY1679   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_FostersB   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_FostersO   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_JAY291   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_JK9-3d   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_K11   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_Kyokai7   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_L1528   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWIIEQRGLYD   150
YHR134W_LalvinQA23   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_PW5   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_RM11-1a   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWIIEQRGLYD   150
YHR134W_RedStar   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_SEY6210   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_SK1   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_T7   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_T73   101   FQFLPMGCIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWIIEQRGLYD   150
YHR134W_UC5   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_UWOPS05_217_3   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_VL3   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWIIEQRGLYD   150
YHR134W_Vin13   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_W303   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_X2180-1A   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_Y55   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_YJM269   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_YJM339   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWIIEQRGLYD   150
YHR134W_YJM789   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_YPH499   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_YPS128   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_YPS163   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_YS9   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
YHR134W_ZTW1   101   FQFLPMECIMGTMLHELTHNLFGPHDKKFYNKLDELIGRQWVIEQRGLYD   150
         

YHR134W_S288C   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_AWRI796   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_BC187   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_BY4741   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_BY4742   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_CEN.PK   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_D273-10B   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_DBVPG6044   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_EC1118   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_EC9-8   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_FL100   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_FY1679   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_FostersB   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLNPEGIS   200
YHR134W_FostersO   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_JAY291   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_JK9-3d   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_K11   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_Kyokai7   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_L1528   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_LalvinQA23   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_PW5   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_RM11-1a   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_RedStar   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_SEY6210   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_SK1   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_T7   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_T73   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_UC5   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKMGKGVKLGSLHPEGIS   200
YHR134W_UWOPS05_217_3   151   TFLGNGQRLGGRASLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_VL3   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_Vin13   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_W303   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_X2180-1A   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_Y55   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_YJM269   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_YJM339   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_YJM789   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_YPH499   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_YPS128   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_YPS163   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_YS9   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
YHR134W_ZTW1   151   TFLGNGQRLGGRANLRSNRYPMTGISTNTGIVRKRGKGVKLGSLHPEGIS   200
         

YHR134W_S288C   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_AWRI796   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_BC187   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_BY4741   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_BY4742   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_CEN.PK   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_D273-10B   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_DBVPG6044   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_EC1118   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_EC9-8   201   SIDRGNSPRELAALAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_FL100   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_FY1679   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_FostersB   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_FostersO   201   SIDRGNSPRELAALAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_JAY291   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_JK9-3d   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_K11   201   SIDRGNSPRELAALAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_Kyokai7   201   SIDRGNSPRELAALAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_L1528   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_LalvinQA23   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_PW5   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_RM11-1a   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_RedStar   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_SEY6210   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_SK1   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_T7   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_T73   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_UC5   201   SIDRGNSPRELAALAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_UWOPS05_217_3   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_VL3   201   SIDRGNSPRELAAFXAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_Vin13   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_W303   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_X2180-1A   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_Y55   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_YJM269   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_YJM339   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_YJM789   201   SIDRGNSPRELAALAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_YPH499   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_YPS128   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_YPS163   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
YHR134W_YS9   201   SIDRGNSPRELAAFAAERRYRDDRWCGETKNNKDQIISDNISSSLEVVIL   250
YHR134W_ZTW1   201   SIDRGNSPRELAALAAERRYRDDRWCGETKNNKDQIISDNNSSSLEVVIL   250
         

YHR134W_S288C   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_AWRI796   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_BC187   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_BY4741   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_BY4742   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_CEN.PK   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_D273-10B   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_DBVPG6044   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_EC1118   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_EC9-8   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_FL100   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_FY1679   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_FostersB   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_FostersO   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_JAY291   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_JK9-3d   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_K11   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_Kyokai7   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_L1528   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_LalvinQA23   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_PW5   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_RM11-1a   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_RedStar   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_SEY6210   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_SK1   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_T7   251   DDEDEVLPGDTPIEVIDLT   269
YHR134W_T73   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_UC5   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_UWOPS05_217_3   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_VL3   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_Vin13   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_W303   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_X2180-1A   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_Y55   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_YJM269   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_YJM339   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_YJM789   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_YPH499   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_YPS128   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_YPS163   251   DDDDEVLPGDTPIEVIDLT   269
YHR134W_YS9   251   DDDDEVLPGDTLIEVIDLT   269
YHR134W_ZTW1   251   DDDDEVLPGDTPIEVIDLT   269
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YHR134W_S288C from SGD:

YHR134W_S288C [source=SGD]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_AWRI796 from AWRI:

YHR134W_AWRI796 [source=AWRI]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9424  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WIIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_BC187 from Stanford:

YHR134W_BC187 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9424  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WIIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_BY4741 from Stanford:

YHR134W_BY4741 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_BY4742 from Stanford:

YHR134W_BY4742 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_CEN.PK from Stanford:

YHR134W_CEN.PK [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_D273-10B from Stanford:

YHR134W_D273-10B [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_DBVPG6044 from Stanford:

YHR134W_DBVPG6044 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9293  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIAHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNINHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_EC1118 from Genoscope:

YHR134W_EC1118 [source=Genoscope]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_EC9-8 from ASinica:

YHR134W_EC9-8 [source=ASinica]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 190  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAALAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_FL100 from Stanford:

YHR134W_FL100 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_FY1679 from Stanford:

YHR134W_FY1679 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_FostersB from AWRI:

YHR134W_FostersB [source=AWRI]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9932  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLNPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_FostersO from AWRI:

YHR134W_FostersO [source=AWRI]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 190  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAALAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_JAY291 from Duke:

YHR134W_JAY291 [source=Duke]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_JK9-3d from Stanford:

YHR134W_JK9-3d [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_K11 from Stanford:

YHR134W_K11 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 190  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAALAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_Kyokai7 from NRIB:

YHR134W_Kyokai7 [source=NRIB]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 190  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAALAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_L1528 from Stanford:

YHR134W_L1528 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9424  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WIIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_LalvinQA23 from AWRI:

YHR134W_LalvinQA23 [source=AWRI]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_PW5 from WashU:

YHR134W_PW5 [source=WashU]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9193  ..

       1  MKTEGIKSPS AKYHDMAGSL RIAHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNINHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_RM11-1a from Stanford:

YHR134W_RM11-1a [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9424  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WIIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_RedStar from Stanford:

YHR134W_RedStar [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_SEY6210 from Stanford:

YHR134W_SEY6210 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_SK1 from Stanford:

YHR134W_SK1 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9293  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIAHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNINHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_T7 from WashU:

YHR134W_T7 [source=WashU]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9606  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNINHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDEDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_T73 from WashU:

YHR134W_T73 [source=WashU]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9467  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMGCIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WIIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_UC5 from WashU:

YHR134W_UC5 [source=WashU]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 120  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKMGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAALAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_UWOPS05_217_3 from Stanford:

YHR134W_UWOPS05_217_3 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 239  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRASLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_VL3 from AWRI:

YHR134W_VL3 [source=AWRI]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 436  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WIIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFXAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_Vin13 from AWRI:

YHR134W_Vin13 [source=AWRI]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_W303 from Stanford:

YHR134W_W303 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_X2180-1A from Stanford:

YHR134W_X2180-1A [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_Y55 from Stanford:

YHR134W_Y55 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9293  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIAHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNINHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_YJM269 from WashU:

YHR134W_YJM269 [source=WashU]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_YJM339 from Stanford:

YHR134W_YJM339 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9424  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WIIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_YJM789 from Stanford:

YHR134W_YJM789 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 190  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAALAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_YPH499 from Stanford:

YHR134W_YPH499 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_YPS128 from Stanford:

YHR134W_YPS128 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9958  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHVQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNINHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_YPS163 from Stanford:

YHR134W_YPS163 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9958  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHVQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNINHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*

Protein Sequence for YHR134W_YS9 from Stanford:

YHR134W_YS9 [source=Stanford]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 9788  ..

       1  MKTEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAAFAAERRY RDDRWCGETK NNKDQIISDN ISSSLEVVIL

     251  DDDDEVLPGD TLIEVIDLT*

Protein Sequence for YHR134W_ZTW1 from Zhejiang:

YHR134W_ZTW1 [source=Zhejiang]  Length: 270  Fri Oct 20 11:22:20 2017  Type: P  Check: 190  ..

       1  MKAEGIKSPS AKYHDMAGSQ RIPHKNPHIQ KVAVLQSKPN KEDALNLIKE

      51  IAHKVSYLMK ENHFKVTNLV EFYPRDQRLL GMNVNHGSKI MLRLRCSTDE

     101  FQFLPMECIM GTMLHELTHN LFGPHDKKFY NKLDELIGRQ WVIEQRGLYD

     151  TFLGNGQRLG GRANLRSNRY PMTGISTNTG IVRKRGKGVK LGSLHPEGIS

     201  SIDRGNSPRE LAALAAERRY RDDRWCGETK NNKDQIISDN NSSSLEVVIL

     251  DDDDEVLPGD TPIEVIDLT*