HXT1/YHR094C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YHR094C_S288C   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_AWRI796   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_BC187   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_BY4741   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_BY4742   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_CEN.PK   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_D273-10B   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_EC1118   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_EC9-8   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_FostersB   1   MNSTPDLISPQKSNSXNSYELESGRSKAMNTPEGKNESFHDNLIESQVQP   50
YHR094C_FostersO   
   --------------------------------------------------   
YHR094C_JK9-3d   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_K11   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSERQVQP   50
YHR094C_Kyokai7   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_L1528   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_LalvinQA23   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_RM11-1a   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_RedStar   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_SEY6210   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_SK1   1   ----------------------------MNTPEGKNESFHDNLSESQVQP   22
YHR094C_T7   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_UC5   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_UWOPS05_217_3   1   MNSTPDLISPQKSNSSNSYELESDRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_VL3   
   --------------------------------------------------   
YHR094C_Vin13   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_W303   1   ----------------------------MNTPEGKNESFHDNLSESQVQP   22
YHR094C_Y55   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_YJM339   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_YJM789   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_YPH499   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_YPS128   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_YPS163   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_YS9   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
YHR094C_ZTW1   1   MNSTPDLISPQKSNSSNSYELESGRSKAMNTPEGKNESFHDNLSESQVQP   50
         

YHR094C_S288C   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_AWRI796   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_BC187   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_BY4741   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_BY4742   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_CEN.PK   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_D273-10B   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_EC1118   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_EC9-8   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_FostersB   51   AVAPPNTGKGAYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_FostersO   1   --------------------MVAFGGFIFGWDTGTISGFVAQTDFLRRFG   30
YHR094C_JK9-3d   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_K11   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_Kyokai7   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_L1528   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_LalvinQA23   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_RM11-1a   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_RedStar   51   AVAPPNTGKGAYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_SEY6210   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_SK1   23   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   72
YHR094C_T7   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_UC5   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_UWOPS05_217_3   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_VL3   
   --------------------------------------------------   
YHR094C_Vin13   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_W303   23   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   72
YHR094C_Y55   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_YJM339   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_YJM789   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_YPH499   51   AVAPPNTGKGVYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_YPS128   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_YPS163   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_YS9   51   AVAPPNTGKGAYVTVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
YHR094C_ZTW1   51   AVAPPNTGKGAYVMVSICCVMVAFGGFIFGWDTGTISGFVAQTDFLRRFG   100
         

YHR094C_S288C   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_AWRI796   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_BC187   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_BY4741   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_BY4742   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_CEN.PK   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_D273-10B   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_EC1118   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_EC9-8   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_FostersB   101   MKHHDGSHYLSKVRTGLIVXIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_FostersO   31   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   80
YHR094C_JK9-3d   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_K11   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_Kyokai7   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_L1528   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_LalvinQA23   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_RM11-1a   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_RedStar   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_SEY6210   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_SK1   73   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   122
YHR094C_T7   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_UC5   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_UWOPS05_217_3   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_VL3   
   --------------------------------------------------   
YHR094C_Vin13   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_W303   73   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   122
YHR094C_Y55   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_YJM339   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_YJM789   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_YPH499   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_YPS128   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_YPS163   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_YS9   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
YHR094C_ZTW1   101   MKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLIVVV   150
         

YHR094C_S288C   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_AWRI796   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_BC187   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_BY4741   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_BY4742   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_CEN.PK   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_D273-10B   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_EC1118   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_EC9-8   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_FostersB   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_FostersO   81   VIYTIGIIIQIASINKWYQYFIG---------------------------   103
YHR094C_JK9-3d   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_K11   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_Kyokai7   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_L1528   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_LalvinQA23   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_RM11-1a   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_RedStar   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_SEY6210   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_SK1   123   VIYTIGIIIQIASINKWYQYFIXXXXXXXXXXXXXXXXXXXXXXXXXXXX   172
YHR094C_T7   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_UC5   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_UWOPS05_217_3   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_VL3   
   --------------------------------------------------   
YHR094C_Vin13   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_W303   123   VIYTIGIIIQIASINKWYQYFIGRIIXXXXXXXXXXXXXXXXXXXXXXXX   172
YHR094C_Y55   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_YJM339   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_YJM789   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_YPH499   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_YPS128   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_YPS163   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_YS9   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
YHR094C_ZTW1   151   VIYTIGIIIQIASINKWYQYFIG---------------------------   173
         

YHR094C_S288C   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_AWRI796   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_BC187   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_BY4741   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_BY4742   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_CEN.PK   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_D273-10B   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_EC1118   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_EC9-8   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_FostersB   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_FostersO   104   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   131
YHR094C_JK9-3d   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_K11   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_Kyokai7   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_L1528   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_LalvinQA23   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_RM11-1a   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_RedStar   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_SEY6210   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_SK1   173   XXXXXXXXXXXXXXXX----IGRIISGLGVGGITVLSPMLISEVAPSEMR   218
YHR094C_T7   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_UC5   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_UWOPS05_217_3   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_VL3   
   --------------------------------------------------   
YHR094C_Vin13   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_W303   173   XXXXXXXXXXXXXXXXXXXXIGRIISGLGVGGITVLSPMLISEVAPSEMR   222
YHR094C_Y55   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_YJM339   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_YJM789   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_YPH499   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_YPS128   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_YPS163   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_YS9   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
YHR094C_ZTW1   174   ----------------------RIISGLGVGGITVLSPMLISEVAPSEMR   201
         

YHR094C_S288C   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_AWRI796   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_BC187   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_BY4741   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_BY4742   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_CEN.PK   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_D273-10B   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_EC1118   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_EC9-8   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_FostersB   202   GTLVSCYQXMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_FostersO   132   GTLVSCYQLMITLGIFLGYCTNFGTMNYSNSVQWRVPLGLCFAWALFMIG   181
YHR094C_JK9-3d   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_K11   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_Kyokai7   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_L1528   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_LalvinQA23   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_RM11-1a   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_RedStar   202   GTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_SEY6210   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_SK1   219   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   268
YHR094C_T7   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_UC5   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_UWOPS05_217_3   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_VL3   
   --------------------------------------------------   
YHR094C_Vin13   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_W303   223   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   272
YHR094C_Y55   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_YJM339   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_YJM789   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_YPH499   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_YPS128   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_YPS163   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_YS9   202   GTLVSCYQLMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
YHR094C_ZTW1   202   GTLVSCYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGLCFAWALFMIG   251
         

YHR094C_S288C   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_AWRI796   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_BC187   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_BY4741   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_BY4742   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_CEN.PK   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_D273-10B   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_EC1118   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_EC9-8   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_FostersB   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_FostersO   182   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   231
YHR094C_JK9-3d   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_K11   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_Kyokai7   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_L1528   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_LalvinQA23   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_RM11-1a   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_RedStar   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_SEY6210   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_SK1   269   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   318
YHR094C_T7   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_UC5   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_UWOPS05_217_3   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_VL3   
   --------------------------------------------------   
YHR094C_Vin13   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_W303   273   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   322
YHR094C_Y55   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_YJM339   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_YJM789   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_YPH499   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEASVE   301
YHR094C_YPS128   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_YPS163   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_YS9   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
YHR094C_ZTW1   252   GMMFVPESPRYLVEAGRIDEARASLAKVNKCPPDHPYIQYELETIEAGVE   301
         

YHR094C_S288C   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_AWRI796   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_BC187   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_BY4741   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_BY4742   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_CEN.PK   302   EMRAAGTASWGELFTGKPAMFQRTIMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_D273-10B   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_EC1118   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_EC9-8   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_FostersB   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_FostersO   232   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   281
YHR094C_JK9-3d   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_K11   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_Kyokai7   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_L1528   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_LalvinQA23   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_RM11-1a   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_RedStar   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_SEY6210   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_SK1   319   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   368
YHR094C_T7   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_UC5   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_UWOPS05_217_3   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_VL3   1   -MRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   49
YHR094C_Vin13   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_W303   323   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   372
YHR094C_Y55   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_YJM339   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_YJM789   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_YPH499   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_YPS128   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_YPS163   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_YS9   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
YHR094C_ZTW1   302   EMRAAGTASWGELFTGKPAMFQRTMMGIMIQSLQQLTGDNYFFYYGTIVF   351
         

YHR094C_S288C   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_AWRI796   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_BC187   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_BY4741   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_BY4742   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_CEN.PK   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_D273-10B   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_EC1118   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_EC9-8   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_FostersB   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_FostersO   282   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   331
YHR094C_JK9-3d   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_K11   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_Kyokai7   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_L1528   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_LalvinQA23   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_RM11-1a   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_RedStar   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_SEY6210   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_SK1   369   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMICCY   418
YHR094C_T7   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_UC5   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_UWOPS05_217_3   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_VL3   50   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   99
YHR094C_Vin13   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_W303   373   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   422
YHR094C_Y55   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMICCY   401
YHR094C_YJM339   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_YJM789   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_YPH499   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_YPS128   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_YPS163   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_YS9   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
YHR094C_ZTW1   352   QAVGLSDSFETSIVFGVVNFFSTCCSLYTVDRFGRRNCLMWGAVGMVCCY   401
         

YHR094C_S288C   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_AWRI796   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_BC187   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_BY4741   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_BY4742   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_CEN.PK   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_D273-10B   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_EC1118   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_EC9-8   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_FostersB   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_FostersO   332   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   381
YHR094C_JK9-3d   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_K11   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_Kyokai7   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_L1528   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_LalvinQA23   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_RM11-1a   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_RedStar   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_SEY6210   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_SK1   419   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   468
YHR094C_T7   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_UC5   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_UWOPS05_217_3   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_VL3   100   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   149
YHR094C_Vin13   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_W303   423   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   472
YHR094C_Y55   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_YJM339   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_YJM789   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_YPH499   402   VVYASVGVTRLWPNGQDQPSSKGAGNCMIVFACFYIFCFATTWAPIAYVV   451
YHR094C_YPS128   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_YPS163   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_YS9   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
YHR094C_ZTW1   402   VVYASVGVTRLWPNGQNNGSSKGAGNCMICFACFYIFCFATTWAPIAYVV   451
         

YHR094C_S288C   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_AWRI796   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_BC187   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_BY4741   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_BY4742   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_CEN.PK   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_D273-10B   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_EC1118   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_EC9-8   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_FostersB   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_FostersO   382   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   431
YHR094C_JK9-3d   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_K11   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITNAINFYYGYVFMGC   501
YHR094C_Kyokai7   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITNAINFYYGYVFMGC   501
YHR094C_L1528   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_LalvinQA23   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_RM11-1a   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_RedStar   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_SEY6210   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_SK1   469   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   518
YHR094C_T7   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_UC5   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITNAINFYYGYVFMGC   501
YHR094C_UWOPS05_217_3   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_VL3   150   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFHGL   199
YHR094C_Vin13   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFIYWCHQLLLRLRFHGL   501
YHR094C_W303   473   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   522
YHR094C_Y55   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_YJM339   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_YJM789   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_YPH499   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_YPS128   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_YPS163   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_YS9   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
YHR094C_ZTW1   452   ISECFPLRVKSKCMSIASAANWIWGFLISFFTPFITGAINFYYGYVFMGC   501
         

YHR094C_S288C   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_AWRI796   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_BC187   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_BY4741   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_BY4742   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_CEN.PK   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_D273-10B   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_EC1118   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_EC9-8   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_FostersB   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_FostersO   432   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   481
YHR094C_JK9-3d   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_K11   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_Kyokai7   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_L1528   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_LalvinQA23   502   MVFAYFYVFFLRSRN-----------------------------------   516
YHR094C_RM11-1a   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_RedStar   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_SEY6210   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_SK1   519   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   568
YHR094C_T7   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_UC5   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_UWOPS05_217_3   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_VL3   200   YGFRLLLRLFLRSRN-----------------------------------   214
YHR094C_Vin13   502   YGFRLLLRLFLRSRN-----------------------------------   516
YHR094C_W303   523   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   572
YHR094C_Y55   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_YJM339   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_YJM789   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_YPH499   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_YPS128   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_YPS163   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_YS9   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
YHR094C_ZTW1   502   MVFAYFYVFFFVPETKGLSLEEVNDMYAEGVLPWKSASWVPVSKRGADYN   551
         

YHR094C_S288C   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_AWRI796   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_BC187   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_BY4741   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_BY4742   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_CEN.PK   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_D273-10B   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_EC1118   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_EC9-8   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_FostersB   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_FostersO   482   ADDLMHDDQPFYKSLFSRK   500
YHR094C_JK9-3d   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_K11   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_Kyokai7   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_L1528   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_LalvinQA23   
   -------------------   
YHR094C_RM11-1a   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_RedStar   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_SEY6210   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_SK1   569   ADDLMHDDQPFYKSLFSRK   587
YHR094C_T7   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_UC5   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_UWOPS05_217_3   552   ADDLMHDDQPFYKRLFSRK   570
YHR094C_VL3   
   -------------------   
YHR094C_Vin13   
   -------------------   
YHR094C_W303   573   ADDLMHDDQPFYKSLFSRK   591
YHR094C_Y55   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_YJM339   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_YJM789   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_YPH499   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_YPS128   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_YPS163   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_YS9   552   ADDLMHDDQPFYKSLFSRK   570
YHR094C_ZTW1   552   ADDLMHDDQPFYKSLFSRK   570
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YHR094C_S288C from SGD:

YHR094C_S288C [source=SGD]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_AWRI796 from AWRI:

YHR094C_AWRI796 [source=AWRI]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_BC187 from Stanford:

YHR094C_BC187 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4526  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_BY4741 from Stanford:

YHR094C_BY4741 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_BY4742 from Stanford:

YHR094C_BY4742 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_CEN.PK from Stanford:

YHR094C_CEN.PK [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4495  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTIMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_D273-10B from Stanford:

YHR094C_D273-10B [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_EC1118 from Genoscope:

YHR094C_EC1118 [source=Genoscope]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4659  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_EC9-8 from ASinica:

YHR094C_EC9-8 [source=ASinica]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_FostersB from AWRI:

YHR094C_FostersB [source=AWRI]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4323  ..

       1  MNSTPDLISP QKSNSXNSYE LESGRSKAMN TPEGKNESFH DNLIESQVQP

      51  AVAPPNTGKG AYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVX IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQX MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_FostersO from AWRI:

YHR094C_FostersO [source=AWRI]  Length: 501  Thu Sep 21 07:53:28 2017  Type: P  Check: 2478  ..

       1  MVAFGGFIFG WDTGTISGFV AQTDFLRRFG MKHHDGSHYL SKVRTGLIVS

      51  IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV VIYTIGIIIQ IASINKWYQY

     101  FIGRIISGLG VGGITVLSPM LISEVAPSEM RGTLVSCYQL MITLGIFLGY

     151  CTNFGTMNYS NSVQWRVPLG LCFAWALFMI GGMMFVPESP RYLVEAGRID

     201  EARASLAKVN KCPPDHPYIQ YELETIEAGV EEMRAAGTAS WGELFTGKPA

     251  MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV FQAVGLSDSF ETSIVFGVVN

     301  FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC YVVYASVGVT RLWPNGQNNG

     351  SSKGAGNCMI CFACFYIFCF ATTWAPIAYV VISECFPLRV KSKCMSIASA

     401  ANWIWGFLIS FFTPFITGAI NFYYGYVFMG CMVFAYFYVF FFVPETKGLS

     451  LEEVNDMYAE GVLPWKSASW VPVSKRGADY NADDLMHDDQ PFYKSLFSRK

     501  *

Protein Sequence for YHR094C_JK9-3d from Stanford:

YHR094C_JK9-3d [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_K11 from Stanford:

YHR094C_K11 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4704  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSERQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITNAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_Kyokai7 from NRIB:

YHR094C_Kyokai7 [source=NRIB]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4750  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITNAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_L1528 from Stanford:

YHR094C_L1528 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4659  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_LalvinQA23 from AWRI:

YHR094C_LalvinQA23 [source=AWRI]  Length: 517  Thu Sep 21 07:53:28 2017  Type: P  Check: 8835  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FLRSRN*

Protein Sequence for YHR094C_RM11-1a from Stanford:

YHR094C_RM11-1a [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4659  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_RedStar from Stanford:

YHR094C_RedStar [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4185  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQL MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_SEY6210 from Stanford:

YHR094C_SEY6210 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_SK1 from Stanford:

YHR094C_SK1 [source=Stanford]  Length: 588  Thu Sep 21 07:53:28 2017  Type: P  Check: 1481  ..

       1  MNTPEGKNES FHDNLSESQV QPAVAPPNTG KGAYVMVSIC CVMVAFGGFI

      51  FGWDTGTISG FVAQTDFLRR FGMKHHDGSH YLSKVRTGLI VSIFNIGCAI

     101  GGIVLAKLGD MYGRRIGLIV VVVIYTIGII IQIASINKWY QYFIXXXXXX

     151  XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXIG RIISGLGVGG

     201  ITVLSPMLIS EVAPSEMRGT LVSCYQVMIT LGIFLGYCTN FGTKNYSNSV

     251  QWRVPLGLCF AWALFMIGGM MFVPESPRYL VEAGRIDEAR ASLAKVNKCP

     301  PDHPYIQYEL ETIEAGVEEM RAAGTASWGE LFTGKPAMFQ RTMMGIMIQS

     351  LQQLTGDNYF FYYGTIVFQA VGLSDSFETS IVFGVVNFFS TCCSLYTVDR

     401  FGRRNCLMWG AVGMICCYVV YASVGVTRLW PNGQNNGSSK GAGNCMICFA

     451  CFYIFCFATT WAPIAYVVIS ECFPLRVKSK CMSIASAANW IWGFLISFFT

     501  PFITGAINFY YGYVFMGCMV FAYFYVFFFV PETKGLSLEE VNDMYAEGVL

     551  PWKSASWVPV SKRGADYNAD DLMHDDQPFY KSLFSRK*

Protein Sequence for YHR094C_T7 from WashU:

YHR094C_T7 [source=WashU]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4526  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_UC5 from WashU:

YHR094C_UC5 [source=WashU]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4750  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITNAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_UWOPS05_217_3 from Stanford:

YHR094C_UWOPS05_217_3 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4402  ..

       1  MNSTPDLISP QKSNSSNSYE LESDRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKRLFSRK *

Protein Sequence for YHR094C_VL3 from AWRI:

YHR094C_VL3 [source=AWRI]  Length: 215  Thu Sep 21 07:53:28 2017  Type: P  Check: 7399  ..

       1  MRAAGTASWG ELFTGKPAMF QRTMMGIMIQ SLQQLTGDNY FFYYGTIVFQ

      51  AVGLSDSFET SIVFGVVNFF STCCSLYTVD RFGRRNCLMW GAVGMVCCYV

     101  VYASVGVTRL WPNGQNNGSS KGAGNCMICF ACFYIFCFAT TWAPIAYVVI

     151  SECFPLRVKS KCMSIASAAN WIWGFLISFF TPFITGAINF YYGYVFHGLY

     201  GFRLLLRLFL RSRN*

Protein Sequence for YHR094C_Vin13 from AWRI:

YHR094C_Vin13 [source=AWRI]  Length: 517  Thu Sep 21 07:53:28 2017  Type: P  Check: 8587  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFIYWCH QLLLRLRFHG

     501  LYGFRLLLRL FLRSRN*

Protein Sequence for YHR094C_W303 from Stanford:

YHR094C_W303 [source=Stanford]  Length: 592  Thu Sep 21 07:53:28 2017  Type: P  Check: 6181  ..

       1  MNTPEGKNES FHDNLSESQV QPAVAPPNTG KGVYVTVSIC CVMVAFGGFI

      51  FGWDTGTISG FVAQTDFLRR FGMKHHDGSH YLSKVRTGLI VSIFNIGCAI

     101  GGIVLAKLGD MYGRRIGLIV VVVIYTIGII IQIASINKWY QYFIGRIIXX

     151  XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXIGRIISGL

     201  GVGGITVLSP MLISEVAPSE MRGTLVSCYQ VMITLGIFLG YCTNFGTKNY

     251  SNSVQWRVPL GLCFAWALFM IGGMMFVPES PRYLVEAGRI DEARASLAKV

     301  NKCPPDHPYI QYELETIEAS VEEMRAAGTA SWGELFTGKP AMFQRTMMGI

     351  MIQSLQQLTG DNYFFYYGTI VFQAVGLSDS FETSIVFGVV NFFSTCCSLY

     401  TVDRFGRRNC LMWGAVGMVC CYVVYASVGV TRLWPNGQDQ PSSKGAGNCM

     451  IVFACFYIFC FATTWAPIAY VVISECFPLR VKSKCMSIAS AANWIWGFLI

     501  SFFTPFITGA INFYYGYVFM GCMVFAYFYV FFFVPETKGL SLEEVNDMYA

     551  EGVLPWKSAS WVPVSKRGAD YNADDLMHDD QPFYKSLFSR K*


Protein Sequence for YHR094C_Y55 from Stanford:

YHR094C_Y55 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 3798  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMICC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_YJM339 from Stanford:

YHR094C_YJM339 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_YJM789 from Stanford:

YHR094C_YJM789 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_YPH499 from Stanford:

YHR094C_YPH499 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 5494  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG VYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEASV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQDQP SSKGAGNCMI VFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_YPS128 from Stanford:

YHR094C_YPS128 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4526  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_YPS163 from Stanford:

YHR094C_YPS163 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4526  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_YS9 from Stanford:

YHR094C_YS9 [source=Stanford]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4185  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVTVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQL MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *

Protein Sequence for YHR094C_ZTW1 from Zhejiang:

YHR094C_ZTW1 [source=Zhejiang]  Length: 571  Thu Sep 21 07:53:28 2017  Type: P  Check: 4526  ..

       1  MNSTPDLISP QKSNSSNSYE LESGRSKAMN TPEGKNESFH DNLSESQVQP

      51  AVAPPNTGKG AYVMVSICCV MVAFGGFIFG WDTGTISGFV AQTDFLRRFG

     101  MKHHDGSHYL SKVRTGLIVS IFNIGCAIGG IVLAKLGDMY GRRIGLIVVV

     151  VIYTIGIIIQ IASINKWYQY FIGRIISGLG VGGITVLSPM LISEVAPSEM

     201  RGTLVSCYQV MITLGIFLGY CTNFGTKNYS NSVQWRVPLG LCFAWALFMI

     251  GGMMFVPESP RYLVEAGRID EARASLAKVN KCPPDHPYIQ YELETIEAGV

     301  EEMRAAGTAS WGELFTGKPA MFQRTMMGIM IQSLQQLTGD NYFFYYGTIV

     351  FQAVGLSDSF ETSIVFGVVN FFSTCCSLYT VDRFGRRNCL MWGAVGMVCC

     401  YVVYASVGVT RLWPNGQNNG SSKGAGNCMI CFACFYIFCF ATTWAPIAYV

     451  VISECFPLRV KSKCMSIASA ANWIWGFLIS FFTPFITGAI NFYYGYVFMG

     501  CMVFAYFYVF FFVPETKGLS LEEVNDMYAE GVLPWKSASW VPVSKRGADY

     551  NADDLMHDDQ PFYKSLFSRK *