COX6/YHR051W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YHR051W_S288C   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_AWRI1631   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_AWRI796   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_BC187   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_BY4741   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_BY4742   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_CBS7960   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_CEN.PK   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_CLIB215   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_D273-10B   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_DBVPG6044   1   MLSRAIFRNPVISRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_EC1118   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_EC9-8   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_FL100   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_FY1679   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_FostersB   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_FostersO   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_JAY291   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_JK9-3d   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_K11   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_Kyokai7   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_L1528   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_LalvinQA23   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_M22   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_PW5   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_RM11-1a   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_RedStar   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_SEY6210   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_SK1   1   MLSRAIFRNPVISRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_T7   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_T73   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_UC5   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_UWOPS05_217_3   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_VL3   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_Vin13   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_W303   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_X2180-1A   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_Y10   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_Y55   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_YJM269   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_YJM339   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_YJM789   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_YPH499   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_YPS128   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_YPS163   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_YS9   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
YHR051W_ZTW1   1   MLSRAIFRNPVINRTLLRARPGAYHATRLTKNTFIQSRKYSDAHDEETFE   50
         

YHR051W_S288C   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_AWRI1631   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_AWRI796   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_BC187   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_BY4741   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_BY4742   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_CBS7960   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_CEN.PK   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_CLIB215   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_D273-10B   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_DBVPG6044   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_EC1118   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_EC9-8   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_FL100   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_FY1679   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_FostersB   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKXLRAARRVND   100
YHR051W_FostersO   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_JAY291   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_JK9-3d   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_K11   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_Kyokai7   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_L1528   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_LalvinQA23   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_M22   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_PW5   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_RM11-1a   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_RedStar   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_SEY6210   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_SK1   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_T7   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_T73   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_UC5   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_UWOPS05_217_3   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_VL3   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_Vin13   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_W303   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_X2180-1A   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_Y10   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_Y55   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_YJM269   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_YJM339   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_YJM789   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_YPH499   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_YPS128   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_YPS163   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_YS9   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
YHR051W_ZTW1   51   EFTARYEKEFDEAYDLFEVQRVLNNCFSYDLVPAPAVIEKALRAARRVND   100
         

YHR051W_S288C   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_AWRI1631   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_AWRI796   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_BC187   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_BY4741   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_BY4742   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_CBS7960   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_CEN.PK   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_CLIB215   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_D273-10B   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_DBVPG6044   101   LPTAIRVFEALKYKVENADQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_EC1118   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_EC9-8   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_FL100   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_FY1679   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_FostersB   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_FostersO   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_JAY291   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_JK9-3d   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_K11   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_Kyokai7   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_L1528   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_LalvinQA23   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_M22   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGIPLKEELFPSSS   148
YHR051W_PW5   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_RM11-1a   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_RedStar   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_SEY6210   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_SK1   101   LPTAIRVFEALKYKVENADQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_T7   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_T73   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_UC5   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_UWOPS05_217_3   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_VL3   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_Vin13   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_W303   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_X2180-1A   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_Y10   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_Y55   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_YJM269   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_YJM339   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_YJM789   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_YPH499   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_YPS128   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_YPS163   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_YS9   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
YHR051W_ZTW1   101   LPTAIRVFEALKYKVENEDQYKAYLDELKDVRQELGVPLKEELFPSSS   148
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YHR051W_S288C from SGD:

YHR051W_S288C [source=SGD]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_AWRI1631 from AWRI:

YHR051W_AWRI1631 [source=AWRI]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_AWRI796 from AWRI:

YHR051W_AWRI796 [source=AWRI]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_BC187 from Stanford:

YHR051W_BC187 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_BY4741 from Stanford:

YHR051W_BY4741 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_BY4742 from Stanford:

YHR051W_BY4742 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_CBS7960 from WashU:

YHR051W_CBS7960 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_CEN.PK from Stanford:

YHR051W_CEN.PK [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_CLIB215 from WashU:

YHR051W_CLIB215 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_D273-10B from Stanford:

YHR051W_D273-10B [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_DBVPG6044 from Stanford:

YHR051W_DBVPG6044 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7692  ..

       1  MLSRAIFRNP VISRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENADQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_EC1118 from Genoscope:

YHR051W_EC1118 [source=Genoscope]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_EC9-8 from ASinica:

YHR051W_EC9-8 [source=ASinica]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_FL100 from Stanford:

YHR051W_FL100 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_FY1679 from Stanford:

YHR051W_FY1679 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_FostersB from AWRI:

YHR051W_FostersB [source=AWRI]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 8425  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK XLRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_FostersO from AWRI:

YHR051W_FostersO [source=AWRI]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_JAY291 from Duke:

YHR051W_JAY291 [source=Duke]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_JK9-3d from Stanford:

YHR051W_JK9-3d [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_K11 from Stanford:

YHR051W_K11 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_Kyokai7 from NRIB:

YHR051W_Kyokai7 [source=NRIB]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_L1528 from Stanford:

YHR051W_L1528 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_LalvinQA23 from AWRI:

YHR051W_LalvinQA23 [source=AWRI]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_M22 from WashU:

YHR051W_M22 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7344  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGIPLK EELFPSSS*


Protein Sequence for YHR051W_PW5 from WashU:

YHR051W_PW5 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_RM11-1a from Stanford:

YHR051W_RM11-1a [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_RedStar from Stanford:

YHR051W_RedStar [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_SEY6210 from Stanford:

YHR051W_SEY6210 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_SK1 from Stanford:

YHR051W_SK1 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7692  ..

       1  MLSRAIFRNP VISRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENADQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_T7 from WashU:

YHR051W_T7 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_T73 from WashU:

YHR051W_T73 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_UC5 from WashU:

YHR051W_UC5 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_UWOPS05_217_3 from Stanford:

YHR051W_UWOPS05_217_3 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_VL3 from AWRI:

YHR051W_VL3 [source=AWRI]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_Vin13 from AWRI:

YHR051W_Vin13 [source=AWRI]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_W303 from Stanford:

YHR051W_W303 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_X2180-1A from Stanford:

YHR051W_X2180-1A [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_Y10 from WashU:

YHR051W_Y10 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_Y55 from Stanford:

YHR051W_Y55 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_YJM269 from WashU:

YHR051W_YJM269 [source=WashU]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_YJM339 from Stanford:

YHR051W_YJM339 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_YJM789 from Stanford:

YHR051W_YJM789 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_YPH499 from Stanford:

YHR051W_YPH499 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_YPS128 from Stanford:

YHR051W_YPS128 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_YPS163 from Stanford:

YHR051W_YPS163 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_YS9 from Stanford:

YHR051W_YS9 [source=Stanford]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*


Protein Sequence for YHR051W_ZTW1 from Zhejiang:

YHR051W_ZTW1 [source=Zhejiang]  Length: 149  Tue Sep 26 13:04:50 2017  Type: P  Check: 7643  ..

       1  MLSRAIFRNP VINRTLLRAR PGAYHATRLT KNTFIQSRKY SDAHDEETFE

      51  EFTARYEKEF DEAYDLFEVQ RVLNNCFSYD LVPAPAVIEK ALRAARRVND

     101  LPTAIRVFEA LKYKVENEDQ YKAYLDELKD VRQELGVPLK EELFPSSS*