GCN5/YGR252W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YGR252W_S288C   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_AWRI1631   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_AWRI796   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_BC187   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_BY4741   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_BY4742   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_CBS7960   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_CEN.PK   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_CLIB215   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_CLIB324   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_D273-10B   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_DBVPG6044   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_EC1118   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_EC9-8   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_FL100   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_FY1679   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_FostersB   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_FostersO   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_JAY291   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_JK9-3d   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_K11   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_Kyokai7   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_L1528   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_LalvinQA23   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_PW5   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_RM11-1a   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_RedStar   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_SEY6210   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_SK1   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_T7   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_UC5   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_UWOPS05_217_3   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_VL3   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_Vin13   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_W303   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_X2180-1A   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_Y10   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_Y55   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_YJM269   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_YJM339   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_YJM789   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_YPH499   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_YPS128   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_YPS163   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_YS9   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
YGR252W_ZTW1   1   MVTKHQIEEDHLDGATTDPEVKRVKLENNVEEIQPEQAETNKQEGTDKEN   50
         

YGR252W_S288C   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_AWRI1631   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_AWRI796   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_BC187   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_BY4741   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_BY4742   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_CBS7960   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_CEN.PK   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_CLIB215   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_CLIB324   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_D273-10B   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_DBVPG6044   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_EC1118   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_EC9-8   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_FL100   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_FY1679   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_FostersB   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_FostersO   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_JAY291   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_JK9-3d   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_K11   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_Kyokai7   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_L1528   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_LalvinQA23   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_PW5   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_RM11-1a   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_RedStar   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_SEY6210   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_SK1   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_T7   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_UC5   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_UWOPS05_217_3   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_VL3   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_Vin13   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_W303   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_X2180-1A   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_Y10   51   KGKFEKETERIGGYEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_Y55   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_YJM269   51   KGKFEKETERIGGYEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_YJM339   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_YJM789   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_YPH499   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_YPS128   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_YPS163   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_YS9   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
YGR252W_ZTW1   51   KGKFEKETERIGGSEVVTDVEKGIVKFEFDGVEYTFKERPSVVEENEGKI   100
         

YGR252W_S288C   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_AWRI1631   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_AWRI796   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_BC187   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_BY4741   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_BY4742   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_CBS7960   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_CEN.PK   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_CLIB215   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_CLIB324   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_D273-10B   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_DBVPG6044   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_EC1118   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_EC9-8   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_FL100   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_FY1679   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_FostersB   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_FostersO   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_JAY291   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_JK9-3d   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_K11   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_Kyokai7   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_L1528   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_LalvinQA23   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_PW5   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_RM11-1a   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_RedStar   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_SEY6210   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_SK1   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_T7   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_UC5   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_UWOPS05_217_3   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_VL3   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_Vin13   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_W303   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_X2180-1A   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_Y10   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_Y55   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_YJM269   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_YJM339   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_YJM789   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_YPH499   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_YPS128   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_YPS163   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_YS9   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
YGR252W_ZTW1   101   EFRVVNNDNTKENMMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAV   150
         

YGR252W_S288C   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_AWRI1631   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_AWRI796   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_BC187   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_BY4741   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_BY4742   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_CBS7960   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_CEN.PK   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_CLIB215   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_CLIB324   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_D273-10B   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSSEQVRGYGAHLMNHLKDYV   200
YGR252W_DBVPG6044   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_EC1118   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_EC9-8   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_FL100   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_FY1679   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_FostersB   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_FostersO   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_JAY291   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_JK9-3d   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_K11   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_Kyokai7   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_L1528   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_LalvinQA23   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_PW5   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_RM11-1a   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_RedStar   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSSEQVRGYGAHLMNHLKDYV   200
YGR252W_SEY6210   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_SK1   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_T7   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_UC5   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_UWOPS05_217_3   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_VL3   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_Vin13   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_W303   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSSEQVRGYGAHLMNHLKDYV   200
YGR252W_X2180-1A   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_Y10   151   IRKPLTVVGGITYRPFYKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_Y55   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_YJM269   151   IRKPLTVVGGITYRPFYKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_YJM339   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_YJM789   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_YPH499   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_YPS128   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_YPS163   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_YS9   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
YGR252W_ZTW1   151   IRKPLTVVGGITYRPFDKREFAEIVFCAISSTEQVRGYGAHLMNHLKDYV   200
         

YGR252W_S288C   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_AWRI1631   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_AWRI796   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_BC187   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_BY4741   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_BY4742   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_CBS7960   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_CEN.PK   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_CLIB215   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_CLIB324   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_D273-10B   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_DBVPG6044   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_EC1118   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_EC9-8   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_FL100   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_FY1679   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_FostersB   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_FostersO   201   RNTSNIKYFLXICR------------------------------------   214
YGR252W_JAY291   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_JK9-3d   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_K11   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_Kyokai7   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_L1528   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_LalvinQA23   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_PW5   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_RM11-1a   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_RedStar   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_SEY6210   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_SK1   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_T7   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_UC5   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_UWOPS05_217_3   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_VL3   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_Vin13   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_W303   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_X2180-1A   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_Y10   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_Y55   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_YJM269   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_YJM339   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_YJM789   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_YPH499   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_YPS128   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_YPS163   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_YS9   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
YGR252W_ZTW1   201   RNTSNIKYFLTYADNYAIGYFKKQGFTKEITLDKSIWMGYIKDYEGGTLM   250
         

YGR252W_S288C   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_AWRI1631   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_AWRI796   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_BC187   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_BY4741   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_BY4742   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_CBS7960   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_CEN.PK   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_CLIB215   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_CLIB324   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_D273-10B   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_DBVPG6044   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_EC1118   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_EC9-8   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_FL100   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_FY1679   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_FostersB   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_FostersO   
   --------------------------------------------------   
YGR252W_JAY291   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_JK9-3d   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_K11   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_Kyokai7   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_L1528   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_LalvinQA23   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_PW5   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_RM11-1a   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_RedStar   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_SEY6210   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_SK1   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_T7   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_UC5   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_UWOPS05_217_3   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_VL3   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_Vin13   251   QCSMLPRIRYLDAGKIFIITRSGPAKKNKNDFEIAYCKAWFRAIQRLKQY   300
YGR252W_W303   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_X2180-1A   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_Y10   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_Y55   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_YJM269   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_YJM339   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_YJM789   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_YPH499   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_YPS128   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_YPS163   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_YS9   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
YGR252W_ZTW1   251   QCSMLPRIRYLDAGKILLLQEAALRRKIRTISKSHIVRPGLEQFKDLNNI   300
         

YGR252W_S288C   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_AWRI1631   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_AWRI796   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_BC187   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_BY4741   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_BY4742   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_CBS7960   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_CEN.PK   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_CLIB215   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_CLIB324   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_D273-10B   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_DBVPG6044   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_EC1118   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_EC9-8   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_FL100   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_FY1679   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_FostersB   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_FostersO   
   --------------------------------------------------   
YGR252W_JAY291   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_JK9-3d   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_K11   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_Kyokai7   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_L1528   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_LalvinQA23   301   KPIDXMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNIXTELQNHAAAW   350
YGR252W_PW5   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_RM11-1a   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_RedStar   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_SEY6210   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_SK1   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_T7   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_UC5   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_UWOPS05_217_3   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_VL3   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_Vin13   301   QTD-----------------------------------------------   303
YGR252W_W303   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_X2180-1A   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_Y10   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_Y55   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_YJM269   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_YJM339   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_YJM789   301   KPIDPMTIPGLKEPAGLRDGCVGATSQAWSTRCSNTEYTHRATKSCSSLA   350
YGR252W_YPH499   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_YPS128   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_YPS163   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_YS9   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
YGR252W_ZTW1   301   KPIDPMTIPGLKEAGWTPEMDALAQRPKRGPHDAAIQNILTELQNHAAAW   350
         

YGR252W_S288C   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_AWRI1631   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_AWRI796   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_BC187   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_BY4741   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_BY4742   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_CBS7960   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_CEN.PK   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_CLIB215   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_CLIB324   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_D273-10B   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_DBVPG6044   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_EC1118   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_EC9-8   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_FL100   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_FY1679   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_FostersB   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_FostersO   
   --------------------------------------------------   
YGR252W_JAY291   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_JK9-3d   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_K11   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_Kyokai7   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_L1528   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_LalvinQA23   351   PLLTTR--------------------------------------------   356
YGR252W_PW5   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_RM11-1a   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_RedStar   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_SEY6210   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_SK1   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_T7   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_UC5   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_UWOPS05_217_3   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_VL3   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_Vin13   
   --------------------------------------------------   
YGR252W_W303   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_X2180-1A   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_Y10   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_Y55   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_YJM269   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_YJM339   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_YJM789   351   LLTTR---------------------------------------------   355
YGR252W_YPH499   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_YPS128   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_YPS163   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_YS9   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
YGR252W_ZTW1   351   PFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVF   400
         

YGR252W_S288C   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_AWRI1631   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_AWRI796   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_BC187   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_BY4741   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_BY4742   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_CBS7960   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_CEN.PK   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_CLIB215   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_CLIB324   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_D273-10B   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_DBVPG6044   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_EC1118   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_EC9-8   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_FL100   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_FY1679   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_FostersB   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_FostersO   
   ---------------------------------------   
YGR252W_JAY291   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_JK9-3d   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_K11   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_Kyokai7   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_L1528   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_LalvinQA23   
   ---------------------------------------   
YGR252W_PW5   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_RM11-1a   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_RedStar   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_SEY6210   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_SK1   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_T7   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_UC5   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_UWOPS05_217_3   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_VL3   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_Vin13   
   ---------------------------------------   
YGR252W_W303   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_X2180-1A   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_Y10   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_Y55   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_YJM269   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_YJM339   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_YJM789   
   ---------------------------------------   
YGR252W_YPH499   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_YPS128   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_YPS163   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_YS9   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
YGR252W_ZTW1   401   NNCRMYNGENTSYYKYANRLEKFFNNKVKEIPEYSHLID   439
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YGR252W_S288C from SGD:

YGR252W_S288C [source=SGD]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_AWRI1631 from AWRI:

YGR252W_AWRI1631 [source=AWRI]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_AWRI796 from AWRI:

YGR252W_AWRI796 [source=AWRI]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_BC187 from Stanford:

YGR252W_BC187 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_BY4741 from Stanford:

YGR252W_BY4741 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_BY4742 from Stanford:

YGR252W_BY4742 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_CBS7960 from WashU:

YGR252W_CBS7960 [source=WashU]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_CEN.PK from Stanford:

YGR252W_CEN.PK [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_CLIB215 from WashU:

YGR252W_CLIB215 [source=WashU]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_CLIB324 from WashU:

YGR252W_CLIB324 [source=WashU]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_D273-10B from Stanford:

YGR252W_D273-10B [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3824  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS SSEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_DBVPG6044 from Stanford:

YGR252W_DBVPG6044 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_EC1118 from Genoscope:

YGR252W_EC1118 [source=Genoscope]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_EC9-8 from ASinica:

YGR252W_EC9-8 [source=ASinica]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_FL100 from Stanford:

YGR252W_FL100 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_FY1679 from Stanford:

YGR252W_FY1679 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_FostersB from AWRI:

YGR252W_FostersB [source=AWRI]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_FostersO from AWRI:

YGR252W_FostersO [source=AWRI]  Length: 215  Thu Feb 22 12:42:58 2018  Type: P  Check: 2417  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL XICR*

Protein Sequence for YGR252W_JAY291 from Duke:

YGR252W_JAY291 [source=Duke]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_JK9-3d from Stanford:

YGR252W_JK9-3d [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_K11 from Stanford:

YGR252W_K11 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_Kyokai7 from NRIB:

YGR252W_Kyokai7 [source=NRIB]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_L1528 from Stanford:

YGR252W_L1528 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_LalvinQA23 from AWRI:

YGR252W_LalvinQA23 [source=AWRI]  Length: 357  Thu Feb 22 12:42:58 2018  Type: P  Check: 3299  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDXMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIX TELQNHAAAW

     351  PLLTTR*

Protein Sequence for YGR252W_PW5 from WashU:

YGR252W_PW5 [source=WashU]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_RM11-1a from Stanford:

YGR252W_RM11-1a [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_RedStar from Stanford:

YGR252W_RedStar [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3824  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS SSEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_SEY6210 from Stanford:

YGR252W_SEY6210 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_SK1 from Stanford:

YGR252W_SK1 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_T7 from WashU:

YGR252W_T7 [source=WashU]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_UC5 from WashU:

YGR252W_UC5 [source=WashU]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_UWOPS05_217_3 from Stanford:

YGR252W_UWOPS05_217_3 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_VL3 from AWRI:

YGR252W_VL3 [source=AWRI]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_Vin13 from AWRI:

YGR252W_Vin13 [source=AWRI]  Length: 304  Thu Feb 22 12:42:58 2018  Type: P  Check: 1961  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKIFIIT RSGPAKKNKN DFEIAYCKAW FRAIQRLKQY

     301  QTD*

Protein Sequence for YGR252W_W303 from Stanford:

YGR252W_W303 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3824  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS SSEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_X2180-1A from Stanford:

YGR252W_X2180-1A [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_Y10 from WashU:

YGR252W_Y10 [source=WashU]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 4990  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGYEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFYKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_Y55 from Stanford:

YGR252W_Y55 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_YJM269 from WashU:

YGR252W_YJM269 [source=WashU]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 4990  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGYEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFYKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_YJM339 from Stanford:

YGR252W_YJM339 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_YJM789 from Stanford:

YGR252W_YJM789 [source=Stanford]  Length: 356  Thu Feb 22 12:42:58 2018  Type: P  Check: 4506  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEPAGLRDG CVGATSQAWS TRCSNTEYTH RATKSCSSLA

     351  LLTTR*

Protein Sequence for YGR252W_YPH499 from Stanford:

YGR252W_YPH499 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_YPS128 from Stanford:

YGR252W_YPS128 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_YPS163 from Stanford:

YGR252W_YPS163 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_YS9 from Stanford:

YGR252W_YS9 [source=Stanford]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*

Protein Sequence for YGR252W_ZTW1 from Zhejiang:

YGR252W_ZTW1 [source=Zhejiang]  Length: 440  Thu Feb 22 12:42:58 2018  Type: P  Check: 3835  ..

       1  MVTKHQIEED HLDGATTDPE VKRVKLENNV EEIQPEQAET NKQEGTDKEN

      51  KGKFEKETER IGGSEVVTDV EKGIVKFEFD GVEYTFKERP SVVEENEGKI

     101  EFRVVNNDNT KENMMVLTGL KNIFQKQLPK MPKEYIARLV YDRSHLSMAV

     151  IRKPLTVVGG ITYRPFDKRE FAEIVFCAIS STEQVRGYGA HLMNHLKDYV

     201  RNTSNIKYFL TYADNYAIGY FKKQGFTKEI TLDKSIWMGY IKDYEGGTLM

     251  QCSMLPRIRY LDAGKILLLQ EAALRRKIRT ISKSHIVRPG LEQFKDLNNI

     301  KPIDPMTIPG LKEAGWTPEM DALAQRPKRG PHDAAIQNIL TELQNHAAAW

     351  PFLQPVNKEE VPDYYDFIKE PMDLSTMEIK LESNKYQKME DFIYDARLVF

     401  NNCRMYNGEN TSYYKYANRL EKFFNNKVKE IPEYSHLID*