SOL4/YGR248W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YGR248W_S288C   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_AWRI1631   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_AWRI796   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_BC187   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_BY4741   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_BY4742   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_CBS7960   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_CEN.PK   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_CLIB324   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_D273-10B   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_DBVPG6044   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_EC1118   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_FL100   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_FY1679   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_FostersB   
   --------------------------------------------------   
YGR248W_FostersO   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_JAY291   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_JK9-3d   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_K11   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_Kyokai7   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_L1528   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_LalvinQA23   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_PW5   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_RM11-1a   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_RedStar   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_SEY6210   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_SK1   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_T7   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_T73   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_UC5   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_UWOPS05_217_3   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_VL3   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_Vin13   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_W303   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_X2180-1A   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_Y55   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_YJM269   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_YJM339   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_YJM789   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_YPH499   1   MVKLQRFSEKKSLIHEFGKFILEKQESALTGDADAVFNIAISGGSMNQAL   50
YGR248W_YPS128   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_YPS163   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_YS9   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
YGR248W_ZTW1   1   MVKLQRFSEKKSLIHEFGKFILEKQDSALTGDADAVFNIAISGGSMNQAL   50
         

YGR248W_S288C   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_AWRI1631   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_AWRI796   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_BC187   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_BY4741   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_BY4742   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_CBS7960   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_CEN.PK   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_CLIB324   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_D273-10B   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_DBVPG6044   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_EC1118   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_FL100   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_FY1679   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_FostersB   1   -----MTKTFFHILSGHNGESSSVNERLVPFEDPQSNYGQFKKTVLDPLV   45
YGR248W_FostersO   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_JAY291   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_JK9-3d   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_K11   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_Kyokai7   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_L1528   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_LalvinQA23   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_PW5   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_RM11-1a   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_RedStar   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_SEY6210   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_SK1   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_T7   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_T73   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_UC5   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_UWOPS05_217_3   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_VL3   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_Vin13   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_W303   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_X2180-1A   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_Y55   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_YJM269   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_YJM339   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_YJM789   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_YPH499   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_YPS128   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_YPS163   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_YS9   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
YGR248W_ZTW1   51   YESLVNDKNIFPHIKWPQWRIFFCDERLVPFEDPQSNYGQFKKTVLDPLV   100
         

YGR248W_S288C   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCG   150
YGR248W_AWRI1631   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_AWRI796   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_BC187   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_BY4741   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCG   150
YGR248W_BY4742   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCG   150
YGR248W_CBS7960   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_CEN.PK   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCG   150
YGR248W_CLIB324   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_D273-10B   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_DBVPG6044   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_EC1118   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_FL100   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_FY1679   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCG   150
YGR248W_FostersB   46   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   95
YGR248W_FostersO   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_JAY291   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_JK9-3d   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_K11   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILRGCG   150
YGR248W_Kyokai7   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_L1528   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_LalvinQA23   101   HQGNQLNLGPTVYTINESLIXGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_PW5   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_RM11-1a   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_RedStar   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_SEY6210   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCG   150
YGR248W_SK1   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_T7   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_T73   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_UC5   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_UWOPS05_217_3   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_VL3   101   HQGNQLNLGPTVYTINESLIGGGEXANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_Vin13   101   HQGNQLNLGPTVYTINESLIXGGEXANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_W303   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_X2180-1A   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCG   150
YGR248W_Y55   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_YJM269   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_YJM339   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_YJM789   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_YPH499   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASMLPASFDLILLGCG   150
YGR248W_YPS128   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_YPS163   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_YS9   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
YGR248W_ZTW1   101   HQGNQLNLGPTVYTINESLIGGGETANRKIAEEYASLLPASFDLILLGCG   150
         

YGR248W_S288C   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_AWRI1631   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_AWRI796   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_BC187   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_BY4741   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_BY4742   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_CBS7960   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_CEN.PK   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_CLIB324   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_D273-10B   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_DBVPG6044   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_EC1118   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_FL100   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_FY1679   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_FostersB   96   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVTEAK   145
YGR248W_FostersO   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVTEAK   200
YGR248W_JAY291   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_JK9-3d   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_K11   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_Kyokai7   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_L1528   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_LalvinQA23   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_PW5   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_RM11-1a   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_RedStar   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_SEY6210   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_SK1   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_T7   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_T73   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_UC5   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_UWOPS05_217_3   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_VL3   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_Vin13   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_W303   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_X2180-1A   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_Y55   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_YJM269   151   GDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_YJM339   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_YJM789   151   EDGHTCSLFPGVEFNYLVEEMDRKILWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_YPH499   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_YPS128   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_YPS163   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_YS9   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
YGR248W_ZTW1   151   EDGHTCSLFPGVEFNYLVEEMDRKVLWCNNSPKAPKDRITFTLAVVAEAK   200
         

YGR248W_S288C   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_AWRI1631   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_AWRI796   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_BC187   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_BY4741   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_BY4742   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_CBS7960   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_CEN.PK   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_CLIB324   201   KCVLSR--------------------------------------------   206
YGR248W_D273-10B   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_DBVPG6044   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_EC1118   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_FL100   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_FY1679   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_FostersB   146   SVCFLVRGAXQKGYHA----------------------------------   161
YGR248W_FostersO   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_JAY291   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_JK9-3d   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_K11   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_Kyokai7   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_L1528   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_LalvinQA23   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_PW5   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_RM11-1a   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_RedStar   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_SEY6210   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_SK1   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_T7   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_T73   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_UC5   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_UWOPS05_217_3   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_VL3   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_Vin13   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_W303   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_X2180-1A   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_Y55   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_YJM269   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_YJM339   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_YJM789   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_YPH499   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_YPS128   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_YPS163   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_YS9   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
YGR248W_ZTW1   201   SVCFLVRGAAKKAIMHDVLIVKNSELPSVLVNEMVGTKVTWFLDDEAGAL   250
         

YGR248W_S288C   251   IPENC   255
YGR248W_AWRI1631   251   IPENC   255
YGR248W_AWRI796   251   IPENC   255
YGR248W_BC187   251   IPENC   255
YGR248W_BY4741   251   IPENC   255
YGR248W_BY4742   251   IPENC   255
YGR248W_CBS7960   251   IPENC   255
YGR248W_CEN.PK   251   IPENC   255
YGR248W_CLIB324   
   -----   
YGR248W_D273-10B   251   IPENC   255
YGR248W_DBVPG6044   251   IPENC   255
YGR248W_EC1118   251   IPENC   255
YGR248W_FL100   251   IPENC   255
YGR248W_FY1679   251   IPENC   255
YGR248W_FostersB   
   -----   
YGR248W_FostersO   251   IPENC   255
YGR248W_JAY291   251   IPENC   255
YGR248W_JK9-3d   251   IPENC   255
YGR248W_K11   251   IPENC   255
YGR248W_Kyokai7   251   IPENC   255
YGR248W_L1528   251   IPENC   255
YGR248W_LalvinQA23   251   IPENC   255
YGR248W_PW5   251   IPENC   255
YGR248W_RM11-1a   251   IPENC   255
YGR248W_RedStar   251   IPENC   255
YGR248W_SEY6210   251   IPENC   255
YGR248W_SK1   251   IPENC   255
YGR248W_T7   251   IPENC   255
YGR248W_T73   251   IPENC   255
YGR248W_UC5   251   IPENC   255
YGR248W_UWOPS05_217_3   251   IPENC   255
YGR248W_VL3   251   IPENC   255
YGR248W_Vin13   251   IPENC   255
YGR248W_W303   251   IPENC   255
YGR248W_X2180-1A   251   IPENC   255
YGR248W_Y55   251   IPENC   255
YGR248W_YJM269   251   IPENC   255
YGR248W_YJM339   251   IPENC   255
YGR248W_YJM789   251   IPENC   255
YGR248W_YPH499   251   IPENC   255
YGR248W_YPS128   251   IPENC   255
YGR248W_YPS163   251   IPENC   255
YGR248W_YS9   251   IPENC   255
YGR248W_ZTW1   251   IPENC   255
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YGR248W_S288C from SGD:

YGR248W_S288C [source=SGD]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 796  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASMLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_AWRI1631 from AWRI:

YGR248W_AWRI1631 [source=AWRI]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_AWRI796 from AWRI:

YGR248W_AWRI796 [source=AWRI]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 695  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_BC187 from Stanford:

YGR248W_BC187 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_BY4741 from Stanford:

YGR248W_BY4741 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 796  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASMLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_BY4742 from Stanford:

YGR248W_BY4742 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 796  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASMLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_CBS7960 from WashU:

YGR248W_CBS7960 [source=WashU]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_CEN.PK from Stanford:

YGR248W_CEN.PK [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 796  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASMLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_CLIB324 from WashU:

YGR248W_CLIB324 [source=WashU]  Length: 207  Sat Sep 23 05:06:41 2017  Type: P  Check: 6101  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  KCVLSR*

Protein Sequence for YGR248W_D273-10B from Stanford:

YGR248W_D273-10B [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 695  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_DBVPG6044 from Stanford:

YGR248W_DBVPG6044 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_EC1118 from Genoscope:

YGR248W_EC1118 [source=Genoscope]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 695  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_FL100 from Stanford:

YGR248W_FL100 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_FY1679 from Stanford:

YGR248W_FY1679 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 796  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASMLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_FostersB from AWRI:

YGR248W_FostersB [source=AWRI]  Length: 162  Sat Sep 23 05:06:41 2017  Type: P  Check: 424  ..

       1  MTKTFFHILS GHNGESSSVN ERLVPFEDPQ SNYGQFKKTV LDPLVHQGNQ

      51  LNLGPTVYTI NESLIGGGET ANRKIAEEYA SLLPASFDLI LLGCGEDGHT

     101  CSLFPGVEFN YLVEEMDRKI LWCNNSPKAP KDRITFTLAV VTEAKSVCFL

     151  VRGAXQKGYH A*

Protein Sequence for YGR248W_FostersO from AWRI:

YGR248W_FostersO [source=AWRI]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 1189  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVTEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_JAY291 from Duke:

YGR248W_JAY291 [source=Duke]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_JK9-3d from Stanford:

YGR248W_JK9-3d [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_K11 from Stanford:

YGR248W_K11 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 945  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILRGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_Kyokai7 from NRIB:

YGR248W_Kyokai7 [source=NRIB]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_L1528 from Stanford:

YGR248W_L1528 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_LalvinQA23 from AWRI:

YGR248W_LalvinQA23 [source=AWRI]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 814  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI XGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_PW5 from WashU:

YGR248W_PW5 [source=WashU]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_RM11-1a from Stanford:

YGR248W_RM11-1a [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_RedStar from Stanford:

YGR248W_RedStar [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_SEY6210 from Stanford:

YGR248W_SEY6210 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 796  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASMLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_SK1 from Stanford:

YGR248W_SK1 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_T7 from WashU:

YGR248W_T7 [source=WashU]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_T73 from WashU:

YGR248W_T73 [source=WashU]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_UC5 from WashU:

YGR248W_UC5 [source=WashU]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_UWOPS05_217_3 from Stanford:

YGR248W_UWOPS05_217_3 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_VL3 from AWRI:

YGR248W_VL3 [source=AWRI]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 739  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGEXANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_Vin13 from AWRI:

YGR248W_Vin13 [source=AWRI]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 858  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI XGGEXANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_W303 from Stanford:

YGR248W_W303 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 695  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_X2180-1A from Stanford:

YGR248W_X2180-1A [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 796  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASMLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_Y55 from Stanford:

YGR248W_Y55 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 695  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_YJM269 from WashU:

YGR248W_YJM269 [source=WashU]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 769  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  GDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_YJM339 from Stanford:

YGR248W_YJM339 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_YJM789 from Stanford:

YGR248W_YJM789 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 695  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKILWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_YPH499 from Stanford:

YGR248W_YPH499 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 796  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQESALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASMLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_YPS128 from Stanford:

YGR248W_YPS128 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_YPS163 from Stanford:

YGR248W_YPS163 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_YS9 from Stanford:

YGR248W_YS9 [source=Stanford]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*

Protein Sequence for YGR248W_ZTW1 from Zhejiang:

YGR248W_ZTW1 [source=Zhejiang]  Length: 256  Sat Sep 23 05:06:41 2017  Type: P  Check: 747  ..

       1  MVKLQRFSEK KSLIHEFGKF ILEKQDSALT GDADAVFNIA ISGGSMNQAL

      51  YESLVNDKNI FPHIKWPQWR IFFCDERLVP FEDPQSNYGQ FKKTVLDPLV

     101  HQGNQLNLGP TVYTINESLI GGGETANRKI AEEYASLLPA SFDLILLGCG

     151  EDGHTCSLFP GVEFNYLVEE MDRKVLWCNN SPKAPKDRIT FTLAVVAEAK

     201  SVCFLVRGAA KKAIMHDVLI VKNSELPSVL VNEMVGTKVT WFLDDEAGAL

     251  IPENC*