TIM13/YGR181W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YGR181W_S288C   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_AWRI1631   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_AWRI796   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_BC187   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_BY4741   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_BY4742   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_CBS7960   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_CEN.PK   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_CLIB215   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_CLIB324   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_D273-10B   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_DBVPG6044   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_EC1118   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVVNAIELV   50
YGR181W_EC9-8   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_FL100   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_FY1679   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_FostersB   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_FostersO   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_JAY291   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_JK9-3d   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_K11   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_Kyokai7   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_L1528   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_LalvinQA23   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVXNAXELV   50
YGR181W_PW5   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_RM11-1a   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_RedStar   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_SEY6210   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_SK1   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_T7   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_T73   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_UC5   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_UWOPS05_217_3   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_VL3   1   MGLSSIFGGGAPSQQKGSSHYCKDNPKPYXQGAEKPNCSRTGCG------   44
YGR181W_Vin13   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVXNAXELV   50
YGR181W_W303   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_X2180-1A   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_Y10   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_Y55   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_YJM269   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_YJM339   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_YJM789   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_YPH499   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_YPS128   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_YPS163   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_YS9   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
YGR181W_ZTW1   1   MGLSSIFGGGAPSQQKEAATTAKTTPNPIAKELKNQIAQELAVANATELV   50
         

YGR181W_S288C   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_AWRI1631   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_AWRI796   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_BC187   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_BY4741   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_BY4742   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_CBS7960   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_CEN.PK   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_CLIB215   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_CLIB324   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_D273-10B   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_DBVPG6044   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_EC1118   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_EC9-8   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_FL100   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_FY1679   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_FostersB   51   NKISENCFEKCLNFPHTLPETMRALISVLAKYMRSWNVISKAYISRIQNA   100
YGR181W_FostersO   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_JAY291   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_JK9-3d   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_K11   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_Kyokai7   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_L1528   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_LalvinQA23   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_PW5   51   NKISENCFEKCLNSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_RM11-1a   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_RedStar   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_SEY6210   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_SK1   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_T7   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_T73   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_UC5   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_UWOPS05_217_3   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_VL3   
   --------------------------------------------------   
YGR181W_Vin13   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_W303   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_X2180-1A   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_Y10   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_Y55   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_YJM269   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_YJM339   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_YJM789   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_YPH499   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_YPS128   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_YPS163   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_YS9   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
YGR181W_ZTW1   51   NKISENCFEKCLTSPYATRN-DACIDQCLAKYMRSWNVISKAYISRIQNA   99
         

YGR181W_S288C   100   SASGEI   105
YGR181W_AWRI1631   100   SASGEI   105
YGR181W_AWRI796   100   SASGEI   105
YGR181W_BC187   100   SASGEI   105
YGR181W_BY4741   100   SASGEI   105
YGR181W_BY4742   100   SASGEI   105
YGR181W_CBS7960   100   SASGEI   105
YGR181W_CEN.PK   100   SASGEI   105
YGR181W_CLIB215   100   SASGEI   105
YGR181W_CLIB324   100   SASGEI   105
YGR181W_D273-10B   100   SASGEI   105
YGR181W_DBVPG6044   100   SASGEI   105
YGR181W_EC1118   100   SASGEI   105
YGR181W_EC9-8   100   SASGEI   105
YGR181W_FL100   100   SASGEI   105
YGR181W_FY1679   100   SASGEI   105
YGR181W_FostersB   101   SASGEI   106
YGR181W_FostersO   100   SASGEI   105
YGR181W_JAY291   100   SASGEI   105
YGR181W_JK9-3d   100   SASGEI   105
YGR181W_K11   100   SASGEI   105
YGR181W_Kyokai7   100   SASGEI   105
YGR181W_L1528   100   SASGEI   105
YGR181W_LalvinQA23   100   SASGEI   105
YGR181W_PW5   100   SASGEI   105
YGR181W_RM11-1a   100   SASGEI   105
YGR181W_RedStar   100   SASGEI   105
YGR181W_SEY6210   100   SASGEI   105
YGR181W_SK1   100   SASGEI   105
YGR181W_T7   100   SASGEI   105
YGR181W_T73   100   SASGEI   105
YGR181W_UC5   100   SASGEI   105
YGR181W_UWOPS05_217_3   100   SASGEI   105
YGR181W_VL3   
   ------   
YGR181W_Vin13   100   SASGEI   105
YGR181W_W303   100   SASGEI   105
YGR181W_X2180-1A   100   SASGEI   105
YGR181W_Y10   100   SASGEI   105
YGR181W_Y55   100   SASGEI   105
YGR181W_YJM269   100   SASGEI   105
YGR181W_YJM339   100   SASGEI   105
YGR181W_YJM789   100   SASGEI   105
YGR181W_YPH499   100   SASGEI   105
YGR181W_YPS128   100   SASGEI   105
YGR181W_YPS163   100   SASGEI   105
YGR181W_YS9   100   SASGEI   105
YGR181W_ZTW1   100   SASGEI   105
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YGR181W_S288C from SGD:

YGR181W_S288C [source=SGD]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_AWRI1631 from AWRI:

YGR181W_AWRI1631 [source=AWRI]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_AWRI796 from AWRI:

YGR181W_AWRI796 [source=AWRI]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_BC187 from Stanford:

YGR181W_BC187 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_BY4741 from Stanford:

YGR181W_BY4741 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_BY4742 from Stanford:

YGR181W_BY4742 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_CBS7960 from WashU:

YGR181W_CBS7960 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_CEN.PK from Stanford:

YGR181W_CEN.PK [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_CLIB215 from WashU:

YGR181W_CLIB215 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_CLIB324 from WashU:

YGR181W_CLIB324 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_D273-10B from Stanford:

YGR181W_D273-10B [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_DBVPG6044 from Stanford:

YGR181W_DBVPG6044 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_EC1118 from Genoscope:

YGR181W_EC1118 [source=Genoscope]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 6030  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVVNAIELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_EC9-8 from ASinica:

YGR181W_EC9-8 [source=ASinica]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_FL100 from Stanford:

YGR181W_FL100 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_FY1679 from Stanford:

YGR181W_FY1679 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_FostersB from AWRI:

YGR181W_FostersB [source=AWRI]  Length: 107  Thu Sep 21 16:49:16 2017  Type: P  Check: 134  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLNFPHTLPE TMRALISVLA KYMRSWNVIS KAYISRIQNA

     101  SASGEI*

Protein Sequence for YGR181W_FostersO from AWRI:

YGR181W_FostersO [source=AWRI]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_JAY291 from Duke:

YGR181W_JAY291 [source=Duke]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_JK9-3d from Stanford:

YGR181W_JK9-3d [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_K11 from Stanford:

YGR181W_K11 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_Kyokai7 from NRIB:

YGR181W_Kyokai7 [source=NRIB]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_L1528 from Stanford:

YGR181W_L1528 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_LalvinQA23 from AWRI:

YGR181W_LalvinQA23 [source=AWRI]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 6823  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVXNAXELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_PW5 from WashU:

YGR181W_PW5 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5587  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLNSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_RM11-1a from Stanford:

YGR181W_RM11-1a [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_RedStar from Stanford:

YGR181W_RedStar [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_SEY6210 from Stanford:

YGR181W_SEY6210 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_SK1 from Stanford:

YGR181W_SK1 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_T7 from WashU:

YGR181W_T7 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_T73 from WashU:

YGR181W_T73 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_UC5 from WashU:

YGR181W_UC5 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_UWOPS05_217_3 from Stanford:

YGR181W_UWOPS05_217_3 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_VL3 from AWRI:

YGR181W_VL3 [source=AWRI]  Length: 45  Thu Sep 21 16:49:16 2017  Type: P  Check: 7325  ..

       1  MGLSSIFGGG APSQQKGSSH YCKDNPKPYX QGAEKPNCSR TGCG*


Protein Sequence for YGR181W_Vin13 from AWRI:

YGR181W_Vin13 [source=AWRI]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 6823  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVXNAXELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_W303 from Stanford:

YGR181W_W303 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_X2180-1A from Stanford:

YGR181W_X2180-1A [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_Y10 from WashU:

YGR181W_Y10 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_Y55 from Stanford:

YGR181W_Y55 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_YJM269 from WashU:

YGR181W_YJM269 [source=WashU]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_YJM339 from Stanford:

YGR181W_YJM339 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_YJM789 from Stanford:

YGR181W_YJM789 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_YPH499 from Stanford:

YGR181W_YPH499 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_YPS128 from Stanford:

YGR181W_YPS128 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_YPS163 from Stanford:

YGR181W_YPS163 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_YS9 from Stanford:

YGR181W_YS9 [source=Stanford]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*

Protein Sequence for YGR181W_ZTW1 from Zhejiang:

YGR181W_ZTW1 [source=Zhejiang]  Length: 106  Thu Sep 21 16:49:16 2017  Type: P  Check: 5623  ..

       1  MGLSSIFGGG APSQQKEAAT TAKTTPNPIA KELKNQIAQE LAVANATELV

      51  NKISENCFEK CLTSPYATRN DACIDQCLAK YMRSWNVISK AYISRIQNAS

     101  ASGEI*