UGA1/YGR019W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YGR019W_S288C   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_AWRI1631   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_AWRI796   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_BC187   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_BY4741   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_BY4742   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_CBS7960   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_CEN.PK   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_CLIB215   
   --------------------------------------------------   
YGR019W_D273-10B   1   MSICEQYYTEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_DBVPG6044   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_EC1118   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_EC9-8   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_FL100   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_FY1679   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_FostersB   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_FostersO   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_JAY291   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_JK9-3d   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_K11   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_Kyokai7   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_L1528   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_LalvinQA23   
   --------------------------------------------------   
YGR019W_PW5   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_RM11-1a   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_RedStar   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_SEY6210   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_SK1   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_T7   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_UC5   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_UWOPS05_217_3   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_VL3   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_Vin13   
   --------------------------------------------------   
YGR019W_W303   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_X2180-1A   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_Y10   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_Y55   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_YJM269   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_YJM339   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_YJM789   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_YPH499   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_YPS128   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_YPS163   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_YS9   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
YGR019W_ZTW1   1   MSICEQYYPEEPTKPTVKTESIPGPESQKQLKELGEVFDTRPAYFLADYE   50
         

YGR019W_S288C   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_AWRI1631   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_AWRI796   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMISALVDR   100
YGR019W_BC187   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_BY4741   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_BY4742   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_CBS7960   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_CEN.PK   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_CLIB215   1   ------------------------------------------MIRALVDR   8
YGR019W_D273-10B   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_DBVPG6044   51   KSLGNYITDVDANTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_EC1118   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_EC9-8   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_FL100   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_FY1679   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_FostersB   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_FostersO   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_JAY291   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_JK9-3d   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_K11   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_Kyokai7   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_L1528   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_LalvinQA23   
   --------------------------------------------------   
YGR019W_PW5   51   KSLGNYITDVDANTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_RM11-1a   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_RedStar   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_SEY6210   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_SK1   51   KSLGNYITDVDANTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_T7   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_UC5   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_UWOPS05_217_3   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_VL3   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_Vin13   
   --------------------------------------------------   
YGR019W_W303   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_X2180-1A   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_Y10   51   KSLGNYITEGDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_Y55   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_YJM269   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_YJM339   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_YJM789   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_YPH499   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_YPS128   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_YPS163   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_YS9   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
YGR019W_ZTW1   51   KSLGNYITDVDGNTYLDLYAQISSIALGYNNPALIKAAQSPEMIRALVDR   100
         

YGR019W_S288C   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_AWRI1631   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_AWRI796   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_BC187   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_BY4741   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_BY4742   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_CBS7960   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_CEN.PK   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_CLIB215   9   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   58
YGR019W_D273-10B   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_DBVPG6044   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_EC1118   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_EC9-8   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_FL100   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_FY1679   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_FostersB   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_FostersO   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_JAY291   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_JK9-3d   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_K11   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_Kyokai7   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_L1528   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_LalvinQA23   
   --------------------------------------------------   
YGR019W_PW5   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_RM11-1a   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_RedStar   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_SEY6210   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_SK1   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_T7   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_UC5   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_UWOPS05_217_3   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_VL3   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_Vin13   
   --------------------------------------------------   
YGR019W_W303   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_X2180-1A   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_Y10   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_Y55   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_YJM269   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_YJM339   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_YJM789   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_YPH499   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_YPS128   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_YPS163   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_YS9   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
YGR019W_ZTW1   101   PALGNFPSKDLDKILKQILKSAPKGQDHVWSGLSGADANELAFKAAFIYY   150
         

YGR019W_S288C   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_AWRI1631   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_AWRI796   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_BC187   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_BY4741   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_BY4742   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_CBS7960   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_CEN.PK   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_CLIB215   59   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   108
YGR019W_D273-10B   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_DBVPG6044   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_EC1118   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_EC9-8   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_FL100   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_FY1679   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_FostersB   151   RAKQRGYDXDFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_FostersO   151   RAKQRGYDXDFSEKENLSVMDNXAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_JAY291   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_JK9-3d   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_K11   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_Kyokai7   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_L1528   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_LalvinQA23   1   ------MMPIFLKRKTCLSWTMXPLAPLILPYYRSREXSTVDCLPPVPQT   44
YGR019W_PW5   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_RM11-1a   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_RedStar   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_SEY6210   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_SK1   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_T7   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_UC5   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_UWOPS05_217_3   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_VL3   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_Vin13   1   -------------------MDNXAPGAPHLAVLSFKRAFHGRLFASGSTT   31
YGR019W_W303   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_X2180-1A   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_Y10   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_Y55   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_YJM269   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_YJM339   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_YJM789   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_YPH499   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_YPS128   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_YPS163   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_YS9   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
YGR019W_ZTW1   151   RAKQRGYDADFSEKENLSVMDNDAPGAPHLAVLSFKRAFHGRLFASGSTT   200
         

YGR019W_S288C   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_AWRI1631   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_AWRI796   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_BC187   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_BY4741   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_BY4742   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_CBS7960   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_CEN.PK   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_CLIB215   109   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   158
YGR019W_D273-10B   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_DBVPG6044   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLVIVEELIK   250
YGR019W_EC1118   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_EC9-8   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_FL100   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_FY1679   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_FostersB   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_FostersO   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_JAY291   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_JK9-3d   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_K11   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_Kyokai7   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_L1528   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_LalvinQA23   45   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   94
YGR019W_PW5   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLVIVEELIK   250
YGR019W_RM11-1a   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_RedStar   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_SEY6210   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_SK1   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLVIVEELIK   250
YGR019W_T7   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_UC5   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_UWOPS05_217_3   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_VL3   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_Vin13   32   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   81
YGR019W_W303   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_X2180-1A   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_Y10   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_Y55   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_YJM269   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_YJM339   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_YJM789   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_YPH499   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDHCLAIVEELIK   250
YGR019W_YPS128   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_YPS163   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_YS9   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
YGR019W_ZTW1   201   CSKPIHKLDFPAFHWPHAEYPSYQYPLDENSDANRKEDDRCLAIVEELIK   250
         

YGR019W_S288C   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_AWRI1631   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_AWRI796   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_BC187   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_BY4741   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_BY4742   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_CBS7960   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_CEN.PK   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_CLIB215   159   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   208
YGR019W_D273-10B   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_DBVPG6044   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_EC1118   251   TWSIPVAAFIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_EC9-8   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_FL100   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_FY1679   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_FostersB   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_FostersO   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_JAY291   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_JK9-3d   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_K11   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_Kyokai7   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_L1528   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_LalvinQA23   95   TWSIPVAAXIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   144
YGR019W_PW5   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_RM11-1a   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_RedStar   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_SEY6210   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_SK1   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_T7   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_UC5   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_UWOPS05_217_3   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_VL3   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_Vin13   82   TWSIPVAAXIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   131
YGR019W_W303   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_X2180-1A   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_Y10   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_Y55   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_YJM269   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_YJM339   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_YJM789   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_YPH499   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_YPS128   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_YPS163   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_YS9   251   TWSIPVAALIIEPIQSEGGDNHASKYLLQKLRDITLKYNVVYIIDEVQTG   300
YGR019W_ZTW1   251   TWSIPVAALIIEPIQSEGGDNHASKYFLQKLRDITLKYNVVYIIDEVQTG   300
         

YGR019W_S288C   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_AWRI1631   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_AWRI796   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_BC187   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_BY4741   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_BY4742   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_CBS7960   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_CEN.PK   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_CLIB215   209   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   258
YGR019W_D273-10B   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_DBVPG6044   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_EC1118   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_EC9-8   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_FL100   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_FY1679   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_FostersB   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_FostersO   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_JAY291   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_JK9-3d   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_K11   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_Kyokai7   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_L1528   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_LalvinQA23   145   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   194
YGR019W_PW5   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_RM11-1a   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_RedStar   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_SEY6210   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_SK1   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_T7   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_UC5   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_UWOPS05_217_3   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_VL3   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_Vin13   132   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   181
YGR019W_W303   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_X2180-1A   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_Y10   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_Y55   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_YJM269   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_YJM339   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_YJM789   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_YPH499   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_YPS128   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_YPS163   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_YS9   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
YGR019W_ZTW1   301   VGATGKLWCHEYADIQPPVDLVTFSKKFQSAGYFFHDPKFIPNKPYRQFN   350
         

YGR019W_S288C   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_AWRI1631   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_AWRI796   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_BC187   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_BY4741   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_BY4742   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_CBS7960   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_CEN.PK   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_CLIB215   259   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   308
YGR019W_D273-10B   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_DBVPG6044   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_EC1118   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_EC9-8   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_FL100   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_FY1679   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_FostersB   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_FostersO   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_JAY291   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_JK9-3d   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_K11   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_Kyokai7   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_L1528   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_LalvinQA23   195   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   244
YGR019W_PW5   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_RM11-1a   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_RedStar   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_SEY6210   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_SK1   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_T7   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_UC5   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_UWOPS05_217_3   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_VL3   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_Vin13   182   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   231
YGR019W_W303   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_X2180-1A   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_Y10   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_Y55   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_YJM269   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_YJM339   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_YJM789   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_YPH499   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_YPS128   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_YPS163   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_YS9   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
YGR019W_ZTW1   351   TWCGEPARMIIAGAIGQEISDKKLTEQCSRVGDYLFKKLEGLQKKYPENF   400
         

YGR019W_S288C   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_AWRI1631   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_AWRI796   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_BC187   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_BY4741   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_BY4742   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_CBS7960   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_CEN.PK   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_CLIB215   309   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   358
YGR019W_D273-10B   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_DBVPG6044   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_EC1118   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_EC9-8   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_FL100   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_FY1679   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_FostersB   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_FostersO   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_JAY291   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_JK9-3d   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_K11   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_Kyokai7   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_L1528   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_LalvinQA23   245   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   294
YGR019W_PW5   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_RM11-1a   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_RedStar   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_SEY6210   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_SK1   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_T7   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_UC5   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_UWOPS05_217_3   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_VL3   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_Vin13   232   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   281
YGR019W_W303   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_X2180-1A   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_Y10   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_Y55   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_YJM269   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_YJM339   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_YJM789   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_YPH499   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_YPS128   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_YPS163   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_YS9   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
YGR019W_ZTW1   401   QNLRGKGRGTFIAWDLPTGEKRDLLLKKLKLNGCNVGGCAVHAVRLRPSL   450
         

YGR019W_S288C   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_AWRI1631   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_AWRI796   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_BC187   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_BY4741   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_BY4742   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_CBS7960   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_CEN.PK   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_CLIB215   359   TFEEKHADIFIEALAKSVNEL   379
YGR019W_D273-10B   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_DBVPG6044   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_EC1118   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_EC9-8   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_FL100   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_FY1679   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_FostersB   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_FostersO   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_JAY291   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_JK9-3d   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_K11   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_Kyokai7   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_L1528   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_LalvinQA23   295   TFEEKHADIFIEALAKSVNEL   315
YGR019W_PW5   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_RM11-1a   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_RedStar   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_SEY6210   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_SK1   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_T7   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_UC5   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_UWOPS05_217_3   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_VL3   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_Vin13   282   TFEEKHADIFIEALAKSVNEL   302
YGR019W_W303   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_X2180-1A   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_Y10   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_Y55   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_YJM269   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_YJM339   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_YJM789   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_YPH499   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_YPS128   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_YPS163   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_YS9   451   TFEEKHADIFIEALAKSVNEL   471
YGR019W_ZTW1   451   TFEEKHADIFIEALAKSVNEL   471
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YGR019W_S288C from SGD:

YGR019W_S288C [source=SGD]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_AWRI1631 from AWRI:

YGR019W_AWRI1631 [source=AWRI]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_AWRI796 from AWRI:

YGR019W_AWRI796 [source=AWRI]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9569  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMISALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_BC187 from Stanford:

YGR019W_BC187 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_BY4741 from Stanford:

YGR019W_BY4741 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_BY4742 from Stanford:

YGR019W_BY4742 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_CBS7960 from WashU:

YGR019W_CBS7960 [source=WashU]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_CEN.PK from Stanford:

YGR019W_CEN.PK [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_CLIB215 from WashU:

YGR019W_CLIB215 [source=WashU]  Length: 380  Sun Sep 24 16:09:28 2017  Type: P  Check: 9383  ..

       1  MIRALVDRPA LGNFPSKDLD KILKQILKSA PKGQDHVWSG LSGADANELA

      51  FKAAFIYYRA KQRGYDADFS EKENLSVMDN DAPGAPHLAV LSFKRAFHGR

     101  LFASGSTTCS KPIHKLDFPA FHWPHAEYPS YQYPLDENSD ANRKEDDRCL

     151  AIVEELIKTW SIPVAALIIE PIQSEGGDNH ASKYFLQKLR DITLKYNVVY

     201  IIDEVQTGVG ATGKLWCHEY ADIQPPVDLV TFSKKFQSAG YFFHDPKFIP

     251  NKPYRQFNTW CGEPARMIIA GAIGQEISDK KLTEQCSRVG DYLFKKLEGL

     301  QKKYPENFQN LRGKGRGTFI AWDLPTGEKR DLLLKKLKLN GCNVGGCAVH

     351  AVRLRPSLTF EEKHADIFIE ALAKSVNEL*

Protein Sequence for YGR019W_D273-10B from Stanford:

YGR019W_D273-10B [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9567  ..

       1  MSICEQYYTE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_DBVPG6044 from Stanford:

YGR019W_DBVPG6044 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9816  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DANTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLVIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_EC1118 from Genoscope:

YGR019W_EC1118 [source=Genoscope]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9345  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAAFI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_EC9-8 from ASinica:

YGR019W_EC9-8 [source=ASinica]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_FL100 from Stanford:

YGR019W_FL100 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_FY1679 from Stanford:

YGR019W_FY1679 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_FostersB from AWRI:

YGR019W_FostersB [source=AWRI]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 566  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDXD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_FostersO from AWRI:

YGR019W_FostersO [source=AWRI]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 606  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDXD FSEKENLSVM DNXAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_JAY291 from Duke:

YGR019W_JAY291 [source=Duke]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_JK9-3d from Stanford:

YGR019W_JK9-3d [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_K11 from Stanford:

YGR019W_K11 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_Kyokai7 from NRIB:

YGR019W_Kyokai7 [source=NRIB]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_L1528 from Stanford:

YGR019W_L1528 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_LalvinQA23 from AWRI:

YGR019W_LalvinQA23 [source=AWRI]  Length: 316  Sun Sep 24 16:09:28 2017  Type: P  Check: 3606  ..

       1  MMPIFLKRKT CLSWTMXPLA PLILPYYRSR EXSTVDCLPP VPQTCSKPIH

      51  KLDFPAFHWP HAEYPSYQYP LDENSDANRK EDDRCLAIVE ELIKTWSIPV

     101  AAXIIEPIQS EGGDNHASKY FLQKLRDITL KYNVVYIIDE VQTGVGATGK

     151  LWCHEYADIQ PPVDLVTFSK KFQSAGYFFH DPKFIPNKPY RQFNTWCGEP

     201  ARMIIAGAIG QEISDKKLTE QCSRVGDYLF KKLEGLQKKY PENFQNLRGK

     251  GRGTFIAWDL PTGEKRDLLL KKLKLNGCNV GGCAVHAVRL RPSLTFEEKH

     301  ADIFIEALAK SVNEL*

Protein Sequence for YGR019W_PW5 from WashU:

YGR019W_PW5 [source=WashU]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9816  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DANTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLVIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_RM11-1a from Stanford:

YGR019W_RM11-1a [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_RedStar from Stanford:

YGR019W_RedStar [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_SEY6210 from Stanford:

YGR019W_SEY6210 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_SK1 from Stanford:

YGR019W_SK1 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9816  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DANTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLVIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_T7 from WashU:

YGR019W_T7 [source=WashU]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_UC5 from WashU:

YGR019W_UC5 [source=WashU]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_UWOPS05_217_3 from Stanford:

YGR019W_UWOPS05_217_3 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_VL3 from AWRI:

YGR019W_VL3 [source=AWRI]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_Vin13 from AWRI:

YGR019W_Vin13 [source=AWRI]  Length: 303  Sun Sep 24 16:09:28 2017  Type: P  Check: 8849  ..

       1  MDNXAPGAPH LAVLSFKRAF HGRLFASGST TCSKPIHKLD FPAFHWPHAE

      51  YPSYQYPLDE NSDANRKEDD RCLAIVEELI KTWSIPVAAX IIEPIQSEGG

     101  DNHASKYFLQ KLRDITLKYN VVYIIDEVQT GVGATGKLWC HEYADIQPPV

     151  DLVTFSKKFQ SAGYFFHDPK FIPNKPYRQF NTWCGEPARM IIAGAIGQEI

     201  SDKKLTEQCS RVGDYLFKKL EGLQKKYPEN FQNLRGKGRG TFIAWDLPTG

     251  EKRDLLLKKL KLNGCNVGGC AVHAVRLRPS LTFEEKHADI FIEALAKSVN

     301  EL*

Protein Sequence for YGR019W_W303 from Stanford:

YGR019W_W303 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_X2180-1A from Stanford:

YGR019W_X2180-1A [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_Y10 from WashU:

YGR019W_Y10 [source=WashU]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9488  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITEG DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_Y55 from Stanford:

YGR019W_Y55 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_YJM269 from WashU:

YGR019W_YJM269 [source=WashU]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_YJM339 from Stanford:

YGR019W_YJM339 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_YJM789 from Stanford:

YGR019W_YJM789 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_YPH499 from Stanford:

YGR019W_YPH499 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9411  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDH CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_YPS128 from Stanford:

YGR019W_YPS128 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_YPS163 from Stanford:

YGR019W_YPS163 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_YS9 from Stanford:

YGR019W_YS9 [source=Stanford]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9825  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYLLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*

Protein Sequence for YGR019W_ZTW1 from Zhejiang:

YGR019W_ZTW1 [source=Zhejiang]  Length: 472  Sun Sep 24 16:09:28 2017  Type: P  Check: 9531  ..

       1  MSICEQYYPE EPTKPTVKTE SIPGPESQKQ LKELGEVFDT RPAYFLADYE

      51  KSLGNYITDV DGNTYLDLYA QISSIALGYN NPALIKAAQS PEMIRALVDR

     101  PALGNFPSKD LDKILKQILK SAPKGQDHVW SGLSGADANE LAFKAAFIYY

     151  RAKQRGYDAD FSEKENLSVM DNDAPGAPHL AVLSFKRAFH GRLFASGSTT

     201  CSKPIHKLDF PAFHWPHAEY PSYQYPLDEN SDANRKEDDR CLAIVEELIK

     251  TWSIPVAALI IEPIQSEGGD NHASKYFLQK LRDITLKYNV VYIIDEVQTG

     301  VGATGKLWCH EYADIQPPVD LVTFSKKFQS AGYFFHDPKF IPNKPYRQFN

     351  TWCGEPARMI IAGAIGQEIS DKKLTEQCSR VGDYLFKKLE GLQKKYPENF

     401  QNLRGKGRGT FIAWDLPTGE KRDLLLKKLK LNGCNVGGCA VHAVRLRPSL

     451  TFEEKHADIF IEALAKSVNE L*