ZRT1/YGL255W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YGL255W_S288C   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_BC187   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_BY4741   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_BY4742   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_CEN.PK   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_D273-10B   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_DBVPG6044   1   MSNVTTPWWKQWDPSEVTLTDETPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_EC1118   1   MSNVTTPWWKQWDPDTVTLSAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_FL100   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_FY1679   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_JK9-3d   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_K11   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_Kyokai7   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_L1528   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_LalvinQA23   
   --------------------------------------------------   
YGL255W_RM11-1a   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_RedStar   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_SEY6210   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_SK1   1   MSNVTTPWWKQWDPSEVTLTDETPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_T7   1   MSNVTTPWWKQWDPSNVTLTDETPDDVWKLCVLENVYFSKNEYNGNLGAR   50
YGL255W_UC5   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_UWOPS05_217_3   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_VL3   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_Vin13   
   --------------------------------------------------   
YGL255W_W303   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_X2180-1A   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_Y55   1   MSNVTTPWWKQWDPSEVTLTDETPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_YJM339   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGENEYNGNLGAR   50
YGL255W_YJM789   1   MSNVTTPWWKQWDPSNVTLTDETPDDVWKLCVLEEVYFGGNEYSGNLGAR   50
YGL255W_YPH499   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_YPS128   1   MSNVTTPWWKQWDPSEVTLTDETPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_YPS163   1   MSNVTTPWWKQWDPSEVTLTDETPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_YS9   1   MSNVTTPWWKQWDPDTVTLTAETPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
YGL255W_ZTW1   1   MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNGNLGAR   50
         

YGL255W_S288C   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_BC187   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_BY4741   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_BY4742   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_CEN.PK   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_D273-10B   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_DBVPG6044   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_EC1118   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_FL100   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_FY1679   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_JK9-3d   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_K11   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_Kyokai7   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_L1528   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_LalvinQA23   1   ---------------MFPLISTKVKRLRIPLYAYLFAKYFGXGVIVAXAF   35
YGL255W_RM11-1a   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_RedStar   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_SEY6210   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_SK1   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_T7   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_UC5   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_UWOPS05_217_3   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_VL3   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_Vin13   
   --------------------------------------------------   
YGL255W_W303   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_X2180-1A   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_Y55   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_YJM339   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_YJM789   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_YPH499   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
YGL255W_YPS128   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_YPS163   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_YS9   51   ISSVFVILFVSTFLTMFPLISTKVKRLRIPLYAYLFAKYFGSGVIVATAF   100
YGL255W_ZTW1   51   ISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAF   100
         

YGL255W_S288C   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_BC187   101   IHLMDPAYGAIGGNTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_BY4741   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_BY4742   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_CEN.PK   101   IHLMDPAYGAIGGNTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_D273-10B   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_DBVPG6044   101   IHLMDPAYGAIGGTTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_EC1118   101   IHLMDPAYGAIGGNTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_FL100   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_FY1679   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_JK9-3d   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_K11   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_Kyokai7   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_L1528   101   IHLMDPAYGEIGGNTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_LalvinQA23   36   IHLMDPAYGAIGGXTCXGQXGNWXXYSWCPAIMLTSLTFTFLTDXFSSVW   85
YGL255W_RM11-1a   101   IHLMDPAYGAIGGNTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_RedStar   101   IHLMDPAYGAIGGNTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_SEY6210   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_SK1   101   IHLMDPAYGAIGGTTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_T7   101   IHLMDPAYGAIGSSTCVGQTGKWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_UC5   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_UWOPS05_217_3   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_VL3   101   IHLMDPAYGAIGGNTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_Vin13   
   --------------------------------------------------   
YGL255W_W303   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_X2180-1A   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_Y55   101   IHLMDPAYGAIGGTTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_YJM339   101   IHLMDPAYGAIGGNTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_YJM789   101   IHLMDPAYGAIGSSTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_YPH499   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_YPS128   101   IHLMDPAYGAIGGTTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_YPS163   101   IHLMDPAYGAIGGTTCVGQTGNWGIYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_YS9   101   IHLMDPAYGAIGGNTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
YGL255W_ZTW1   101   IHLMDPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVW   150
         

YGL255W_S288C   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_BC187   151   VERKYGLSHDHTNDEIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_BY4741   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_BY4742   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_CEN.PK   151   VERKYGLSHDHTHDDIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_D273-10B   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_DBVPG6044   151   VERKYGLSHDHTHDDIKDTVVNNAAVVSTENENENGIASGSHDTKNGIEY   200
YGL255W_EC1118   151   VERKYGLSHDHTNDEIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_FL100   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_FY1679   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_JK9-3d   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_K11   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_Kyokai7   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_L1528   151   VERKYGLSHDHTNDEIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_LalvinQA23   86   VERKYXLXXDHTXDXIKDTVVNNAAVVSTENENENGXANGSHDTKNGIEY   135
YGL255W_RM11-1a   151   VERKYGLSHDHTNDEIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_RedStar   151   VERKYGLSHDHTNDEIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_SEY6210   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_SK1   151   VERKYGLSHDHTHDDIKDTVVNNAAVVSTENENENGIASGSHDTKNGIEY   200
YGL255W_T7   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_UC5   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_UWOPS05_217_3   151   VERKYGLSHDHAHDDIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_VL3   151   VERKYGLSHDHTNDEIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_Vin13   
   --------------------------------------------------   
YGL255W_W303   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_X2180-1A   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_Y55   151   VERKYGLSHDHTHDDIKDTVVNNAAVVSTENENENGIASGSHDTKNGIEY   200
YGL255W_YJM339   151   VERKYGLSHDHTNDEIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_YJM789   151   VERKYGLSHDHTHDEIKDTLVRNTAAVSTENDNENGTANGSHDTKNGVEY   200
YGL255W_YPH499   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
YGL255W_YPS128   151   VERKYGLSHDHTHDDIKDTVVNNAAVVSTENENENATANGSHDTKNGIEY   200
YGL255W_YPS163   151   VERKYGLSHDHTHDDIKDTVVNNAAVVSTENENENATANGSHDTKNGIEY   200
YGL255W_YS9   151   VERKYGLSHDHTNDEIKDTVVNNAAVVSTE--NENGTANGSHDTKNGIEY   198
YGL255W_ZTW1   151   VERKYGLSHDHTHDEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEY   200
         

YGL255W_S288C   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_BC187   199   FEESDATSVDVVQSFQTQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   248
YGL255W_BY4741   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_BY4742   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_CEN.PK   199   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATL   248
YGL255W_D273-10B   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_DBVPG6044   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   250
YGL255W_EC1118   199   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   248
YGL255W_FL100   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_FY1679   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_JK9-3d   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_K11   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_Kyokai7   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_L1528   199   FEESDATSVDVVQSFQTQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   248
YGL255W_LalvinQA23   136   XEXSDATSXDVVQSFQXQFYAFLILEXGXIFHXVMIGLNLGSTGKEFATL   185
YGL255W_RM11-1a   199   FEESDATSVDVVQSFQTQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATL   248
YGL255W_RedStar   199   FEESDATSVDVVQSFQTQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATL   248
YGL255W_SEY6210   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_SK1   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   250
YGL255W_T7   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_UC5   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_UWOPS05_217_3   199   FEESDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATL   248
YGL255W_VL3   199   FEESDATSVDVVQSFQTQFYAFLILEFGVIFHSVMIGLNLGSTGEEFATL   248
YGL255W_Vin13   1   ---------MLFNHFKHNFMSFLILEXGXIFHXVMIGLNLGSTGKEFATL   41
YGL255W_W303   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_X2180-1A   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_Y55   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   250
YGL255W_YJM339   199   FEESDATSVDVVQSFQTQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   248
YGL255W_YJM789   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGKEFSSL   250
YGL255W_YPH499   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
YGL255W_YPS128   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   250
YGL255W_YPS163   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSTGKEFATL   250
YGL255W_YS9   199   FEESDATSVDVVQSFQTQFYAFLILEFGVIFHSVMIGLNLGSVGKEFSTL   248
YGL255W_ZTW1   201   YEDSDATSMDVVQSFQAQFYAFLILEFGVIFHSVMIGLNLGSVGDEFSSL   250
         

YGL255W_S288C   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_BC187   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_BY4741   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_BY4742   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_CEN.PK   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_D273-10B   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_DBVPG6044   251   YPVLVFHQSFEGLGIGARMSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_EC1118   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_FL100   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_FY1679   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_JK9-3d   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_K11   251   YPVLMFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_Kyokai7   251   YPVLMFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_L1528   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_LalvinQA23   186   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICXAIG   235
YGL255W_RM11-1a   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_RedStar   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_SEY6210   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_SK1   251   YPVLVFHQSFEGLGIGARMSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_T7   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_UC5   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_UWOPS05_217_3   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCIAYGLTTPICVAIG   298
YGL255W_VL3   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_Vin13   42   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICXAIG   91
YGL255W_W303   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_X2180-1A   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_Y55   251   YPVLVFHQSFEGLGIGARMSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_YJM339   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_YJM789   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_YPH499   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_YPS128   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_YPS163   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
YGL255W_YS9   249   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   298
YGL255W_ZTW1   251   YPVLVFHQSFEGLGIGARLSAIEFPRSKRWWPWALCVAYGLTTPICVAIG   300
         

YGL255W_S288C   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_BC187   299   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPHRTK   348
YGL255W_BY4741   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_BY4742   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_CEN.PK   299   LGVRTQYVSGSYTALVVSGVLDAISAGILLYTGLVELLARDFIFNPQRTK   348
YGL255W_D273-10B   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_DBVPG6044   301   LGVRTQYVSGSYTALVVSGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_EC1118   299   LGVRTQYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   348
YGL255W_FL100   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_FY1679   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_JK9-3d   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_K11   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_Kyokai7   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_L1528   299   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPHRTK   348
YGL255W_LalvinQA23   236   LGVRXXYVSGSYTALVXSGVLDAISAGILLYTGLVELLARDFIFNPXRTK   285
YGL255W_RM11-1a   299   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPHRTK   348
YGL255W_RedStar   299   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPHRTK   348
YGL255W_SEY6210   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_SK1   301   LGVRTQYVSGSYTALVVSGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_T7   301   LGVRTQYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_UC5   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_UWOPS05_217_3   299   LGVRTQYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   348
YGL255W_VL3   299   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPHRTK   348
YGL255W_Vin13   92   LGVRXXYVSGSYTALVXSGVLDAISAGILLYTGLVELLARDFIFNPXRTK   141
YGL255W_W303   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_X2180-1A   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_Y55   301   LGVRTQYVSGSYTALVVSGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_YJM339   299   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPHRTK   348
YGL255W_YJM789   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_YPH499   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_YPS128   301   LGVRTQYVSGSYTALVVSGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_YPS163   301   LGVRTQYVSGSYTALVVSGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
YGL255W_YS9   299   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   348
YGL255W_ZTW1   301   LGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLARDFIFNPQRTK   350
         

YGL255W_S288C   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_BC187   349   NLKELSFNVICTLFGAGIMALIGKWA   374
YGL255W_BY4741   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_BY4742   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_CEN.PK   349   DLRQLSFNVICTLFGAGIMALIGKWA   374
YGL255W_D273-10B   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_DBVPG6044   351   DLRQLSFNVICTLFGAGIMALIGKWA   376
YGL255W_EC1118   349   NLKELSFNVICTLFGAGIMALIGKWA   374
YGL255W_FL100   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_FY1679   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_JK9-3d   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_K11   351   DLRELSFNVICTLFGAGIMALIGKWV   376
YGL255W_Kyokai7   351   DLRELSFNVICTLFGAGIMALIGKWV   376
YGL255W_L1528   349   NLKELSFNVICTLFGAGIMALIGKWA   374
YGL255W_LalvinQA23   286   XXXXXSFNVICTLFGAGIMALIGKWA   311
YGL255W_RM11-1a   349   NLKELSFNVICTLFGAGIMALIGKWA   374
YGL255W_RedStar   349   NLKELSFNVICTLFGAGIMALIGKWA   374
YGL255W_SEY6210   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_SK1   351   DLRQLSFNVICTLFGAGIMALIGKWA   376
YGL255W_T7   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_UC5   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_UWOPS05_217_3   349   DLRELSFNVICTLFGAGIMALIGKWA   374
YGL255W_VL3   349   NLKELSFNVICTLFGAGIMALIGKWA   374
YGL255W_Vin13   142   XXXXXSFNVICTLFGAGIMALIGKWA   167
YGL255W_W303   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_X2180-1A   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_Y55   351   DLRQLSFNVICTLFGAGIMALIGKWA   376
YGL255W_YJM339   349   NLKELSFNVICTLFGAGIMALIGKWA   374
YGL255W_YJM789   351   DLRELSFDVICTLFGAGIMALIGKWA   376
YGL255W_YPH499   351   DLRELSFNVICTLFGAGIMALIGKWA   376
YGL255W_YPS128   351   DLRQLSFNVICTLFGAGIMALIGKWA   376
YGL255W_YPS163   351   DLRQLSFNVICTLFGAGIMALIGKWA   376
YGL255W_YS9   349   DLRELSFNVICTLFGAGIMALIGKWA   374
YGL255W_ZTW1   351   DLRELSFNVICTLFGAGIMALIGKWA   376
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YGL255W_S288C from SGD:

YGL255W_S288C [source=SGD]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_BC187 from Stanford:

YGL255W_BC187 [source=Stanford]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 8835  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGNTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTNDEIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYFE

     201  ESDATSVDVV QSFQTQFYAF LILEFGVIFH SVMIGLNLGS TGKEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTRYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPHRTKNL

     351  KELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_BY4741 from Stanford:

YGL255W_BY4741 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_BY4742 from Stanford:

YGL255W_BY4742 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_CEN.PK from Stanford:

YGL255W_CEN.PK [source=Stanford]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 8220  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGNTCVGQT GNWGIYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDDIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYYE

     201  DSDATSMDVV QSFQAQFYAF LILEFGVIFH SVMIGLNLGS TGEEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTQYVSGSY TALVVSGVLD AISAGILLYT GLVELLARDF IFNPQRTKDL

     351  RQLSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_D273-10B from Stanford:

YGL255W_D273-10B [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_DBVPG6044 from Stanford:

YGL255W_DBVPG6044 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4039  ..

       1  MSNVTTPWWK QWDPSEVTLT DETPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGIYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDDIKDTV VNNAAVVSTE NENENGIASG SHDTKNGIEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSTGKEFATL

     251  YPVLVFHQSF EGLGIGARMS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTQYVSG SYTALVVSGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRQLSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_EC1118 from Genoscope:

YGL255W_EC1118 [source=Genoscope]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 8165  ..

       1  MSNVTTPWWK QWDPDTVTLS AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGNTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTNDEIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYYE

     201  DSDATSMDVV QSFQAQFYAF LILEFGVIFH SVMIGLNLGS TGKEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTQYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPQRTKNL

     351  KELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_FL100 from Stanford:

YGL255W_FL100 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_FY1679 from Stanford:

YGL255W_FY1679 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_JK9-3d from Stanford:

YGL255W_JK9-3d [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_K11 from Stanford:

YGL255W_K11 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4894  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLMFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWV*

Protein Sequence for YGL255W_Kyokai7 from NRIB:

YGL255W_Kyokai7 [source=NRIB]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4894  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLMFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWV*

Protein Sequence for YGL255W_L1528 from Stanford:

YGL255W_L1528 [source=Stanford]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 9089  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGE IGGNTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTNDEIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYFE

     201  ESDATSVDVV QSFQTQFYAF LILEFGVIFH SVMIGLNLGS TGKEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTRYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPHRTKNL

     351  KELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_LalvinQA23 from AWRI:

YGL255W_LalvinQA23 [source=AWRI]  Length: 312  Fri Nov 24 19:50:24 2017  Type: P  Check: 7564  ..

       1  MFPLISTKVK RLRIPLYAYL FAKYFGXGVI VAXAFIHLMD PAYGAIGGXT

      51  CXGQXGNWXX YSWCPAIMLT SLTFTFLTDX FSSVWVERKY XLXXDHTXDX

     101  IKDTVVNNAA VVSTENENEN GXANGSHDTK NGIEYXEXSD ATSXDVVQSF

     151  QXQFYAFLIL EXGXIFHXVM IGLNLGSTGK EFATLYPVLV FHQSFEGLGI

     201  GARLSAIEFP RSKRWWPWAL CVAYGLTTPI CXAIGLGVRX XYVSGSYTAL

     251  VXSGVLDAIS AGILLYTGLV ELLARDFIFN PXRTKXXXXX SFNVICTLFG

     301  AGIMALIGKW A*

Protein Sequence for YGL255W_RM11-1a from Stanford:

YGL255W_RM11-1a [source=Stanford]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 8745  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGNTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTNDEIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYFE

     201  ESDATSVDVV QSFQTQFYAF LILEFGVIFH SVMIGLNLGS TGEEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTRYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPHRTKNL

     351  KELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_RedStar from Stanford:

YGL255W_RedStar [source=Stanford]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 8787  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGNTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTNDEIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYFE

     201  ESDATSVDVV QSFQTQFYAF LILEFGVIFH SVMIGLNLGS TGEEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTRYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPHRTKNL

     351  KELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_SEY6210 from Stanford:

YGL255W_SEY6210 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_SK1 from Stanford:

YGL255W_SK1 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4039  ..

       1  MSNVTTPWWK QWDPSEVTLT DETPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGIYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDDIKDTV VNNAAVVSTE NENENGIASG SHDTKNGIEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSTGKEFATL

     251  YPVLVFHQSF EGLGIGARMS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTQYVSG SYTALVVSGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRQLSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_T7 from WashU:

YGL255W_T7 [source=WashU]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 5610  ..

       1  MSNVTTPWWK QWDPSNVTLT DETPDDVWKL CVLENVYFSK NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGSSTCVGQT GKWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTQYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_UC5 from WashU:

YGL255W_UC5 [source=WashU]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_UWOPS05_217_3 from Stanford:

YGL255W_UWOPS05_217_3 [source=Stanford]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 5930  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HAHDDIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYFE

     201  ESDATSMDVV QSFQAQFYAF LILEFGVIFH SVMIGLNLGS TGEEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCIAYGLT TPICVAIGLG

     301  VRTQYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPQRTKDL

     351  RELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_VL3 from AWRI:

YGL255W_VL3 [source=AWRI]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 8745  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGNTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTNDEIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYFE

     201  ESDATSVDVV QSFQTQFYAF LILEFGVIFH SVMIGLNLGS TGEEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTRYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPHRTKNL

     351  KELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_Vin13 from AWRI:

YGL255W_Vin13 [source=AWRI]  Length: 168  Fri Nov 24 19:50:24 2017  Type: P  Check: 6517  ..

       1  MLFNHFKHNF MSFLILEXGX IFHXVMIGLN LGSTGKEFAT LYPVLVFHQS

      51  FEGLGIGARL SAIEFPRSKR WWPWALCVAY GLTTPICXAI GLGVRXXYVS

     101  GSYTALVXSG VLDAISAGIL LYTGLVELLA RDFIFNPXRT KXXXXXSFNV

     151  ICTLFGAGIM ALIGKWA*

Protein Sequence for YGL255W_W303 from Stanford:

YGL255W_W303 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_X2180-1A from Stanford:

YGL255W_X2180-1A [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_Y55 from Stanford:

YGL255W_Y55 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4039  ..

       1  MSNVTTPWWK QWDPSEVTLT DETPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGIYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDDIKDTV VNNAAVVSTE NENENGIASG SHDTKNGIEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSTGKEFATL

     251  YPVLVFHQSF EGLGIGARMS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTQYVSG SYTALVVSGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRQLSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_YJM339 from Stanford:

YGL255W_YJM339 [source=Stanford]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 8877  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGE NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGNTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTNDEIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYFE

     201  ESDATSVDVV QSFQTQFYAF LILEFGVIFH SVMIGLNLGS TGKEFATLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTRYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPHRTKNL

     351  KELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_YJM789 from Stanford:

YGL255W_YJM789 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4339  ..

       1  MSNVTTPWWK QWDPSNVTLT DETPDDVWKL CVLEEVYFGG NEYSGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGSSTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTL VRNTAAVSTE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGKEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFDVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_YPH499 from Stanford:

YGL255W_YPH499 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_YPS128 from Stanford:

YGL255W_YPS128 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 3994  ..

       1  MSNVTTPWWK QWDPSEVTLT DETPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGIYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDDIKDTV VNNAAVVSTE NENENATANG SHDTKNGIEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSTGKEFATL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTQYVSG SYTALVVSGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRQLSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_YPS163 from Stanford:

YGL255W_YPS163 [source=Stanford]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 3994  ..

       1  MSNVTTPWWK QWDPSEVTLT DETPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGIYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDDIKDTV VNNAAVVSTE NENENATANG SHDTKNGIEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSTGKEFATL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTQYVSG SYTALVVSGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRQLSFNVI CTLFGAGIMA LIGKWA*

Protein Sequence for YGL255W_YS9 from Stanford:

YGL255W_YS9 [source=Stanford]  Length: 375  Fri Nov 24 19:50:24 2017  Type: P  Check: 9327  ..

       1  MSNVTTPWWK QWDPDTVTLT AETPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFLTMFPLI STKVKRLRIP LYAYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGNTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTNDEIKDTV VNNAAVVSTE NENGTANGSH DTKNGIEYFE

     201  ESDATSVDVV QSFQTQFYAF LILEFGVIFH SVMIGLNLGS VGKEFSTLYP

     251  VLVFHQSFEG LGIGARLSAI EFPRSKRWWP WALCVAYGLT TPICVAIGLG

     301  VRTRYVSGSY TALVISGVLD AISAGILLYT GLVELLARDF IFNPQRTKDL

     351  RELSFNVICT LFGAGIMALI GKWA*

Protein Sequence for YGL255W_ZTW1 from Zhejiang:

YGL255W_ZTW1 [source=Zhejiang]  Length: 377  Fri Nov 24 19:50:24 2017  Type: P  Check: 4423  ..

       1  MSNVTTPWWK QWDPSEVTLA DKTPDDVWKT CVLQGVYFGG NEYNGNLGAR

      51  ISSVFVILFV STFFTMFPLI STKVKRLRIP LYVYLFAKYF GSGVIVATAF

     101  IHLMDPAYGA IGGTTCVGQT GNWGLYSWCP AIMLTSLTFT FLTDLFSSVW

     151  VERKYGLSHD HTHDEIKDTV VRNTAAVSSE NDNENGTANG SHDTKNGVEY

     201  YEDSDATSMD VVQSFQAQFY AFLILEFGVI FHSVMIGLNL GSVGDEFSSL

     251  YPVLVFHQSF EGLGIGARLS AIEFPRSKRW WPWALCVAYG LTTPICVAIG

     301  LGVRTRYVSG SYTALVISGV LDAISAGILL YTGLVELLAR DFIFNPQRTK

     351  DLRELSFNVI CTLFGAGIMA LIGKWA*