HXK2/YGL253W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YGL253W_S288C   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_AWRI796   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_BC187   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_BY4741   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_BY4742   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_CBS7960   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_CEN.PK   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_CLIB215   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_CLIB324   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_D273-10B   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_DBVPG6044   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_EC1118   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_FL100   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_FY1679   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_FostersB   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_FostersO   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_JAY291   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_JK9-3d   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_K11   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_Kyokai7   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_L1528   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_LalvinQA23   1   --------------------------MSNSHKVSLSQFHWVSPFLSQLLK   24
YGL253W_M22   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_PW5   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_RM11-1a   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_RedStar   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_SEY6210   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_SK1   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_T7   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_UC5   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_UWOPS05_217_3   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_VL3   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_Vin13   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_W303   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_X2180-1A   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_Y55   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_YJM339   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_YJM789   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_YPH499   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_YPS128   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_YPS163   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_YS9   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
YGL253W_ZTW1   1   MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVTKHFIS   50
         

YGL253W_S288C   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_AWRI796   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_BC187   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_BY4741   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_BY4742   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_CBS7960   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_CEN.PK   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_CLIB215   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_CLIB324   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_D273-10B   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_DBVPG6044   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_EC1118   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_FL100   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_FY1679   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_FostersB   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVXVKLG   100
YGL253W_FostersO   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_JAY291   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_JK9-3d   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_K11   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_Kyokai7   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_L1528   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_LalvinQA23   25   TKSMKVSCKDGLKVLX----------------------------------   40
YGL253W_M22   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_PW5   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_RM11-1a   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_RedStar   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_SEY6210   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_SK1   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_T7   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_UC5   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_UWOPS05_217_3   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_VL3   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_Vin13   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_W303   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_X2180-1A   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_Y55   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_YJM339   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_YJM789   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_YPH499   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_YPS128   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_YPS163   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_YS9   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
YGL253W_ZTW1   51   ELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLG   100
         

YGL253W_S288C   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_AWRI796   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_BC187   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_BY4741   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_BY4742   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_CBS7960   101   GDRTFDTTQSKYRLPDAMKTTQNPDELGEFIADSLKAFIDEQFPQGISEP   150
YGL253W_CEN.PK   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_CLIB215   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_CLIB324   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_D273-10B   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_DBVPG6044   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_EC1118   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_FL100   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_FY1679   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_FostersB   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_FostersO   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_JAY291   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_JK9-3d   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_K11   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_Kyokai7   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_L1528   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_LalvinQA23   
   --------------------------------------------------   
YGL253W_M22   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_PW5   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_RM11-1a   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_RedStar   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_SEY6210   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_SK1   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_T7   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_UC5   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_UWOPS05_217_3   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_VL3   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_Vin13   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_W303   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_X2180-1A   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_Y55   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_YJM339   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_YJM789   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_YPH499   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_YPS128   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_YPS163   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_YS9   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
YGL253W_ZTW1   101   GDRTFDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEP   150
         

YGL253W_S288C   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_AWRI796   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_BC187   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_BY4741   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_BY4742   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_CBS7960   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_CEN.PK   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_CLIB215   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_CLIB324   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_D273-10B   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_DBVPG6044   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_EC1118   151   IPLGFTFSFPASQNKINEGILQRWTKGFDVPNIENHDVVPMLQKQITKRN   200
YGL253W_FL100   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_FY1679   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_FostersB   151   IPLGFTFSFPXSQNKINEGILQRWTKGFDIPNIENHDVXPMLQKQITKRN   200
YGL253W_FostersO   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_JAY291   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_JK9-3d   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_K11   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_Kyokai7   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_L1528   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_LalvinQA23   41   -----------------------------FQTLKNHDVVPMLQKQITKRN   61
YGL253W_M22   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_PW5   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_RM11-1a   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_RedStar   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_SEY6210   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_SK1   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_T7   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_UC5   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_UWOPS05_217_3   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_VL3   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_Vin13   151   IPLGFTFSFPASQNKINEGILQRWTKGFDXPNIENHDVVPMLQKQITKRN   200
YGL253W_W303   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_X2180-1A   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_Y55   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_YJM339   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_YJM789   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_YPH499   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_YPS128   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_YPS163   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_YS9   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
YGL253W_ZTW1   151   IPLGFTFSFPASQNKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRN   200
         

YGL253W_S288C   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_AWRI796   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_BC187   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_BY4741   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_BY4742   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_CBS7960   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_CEN.PK   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_CLIB215   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_CLIB324   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_D273-10B   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_DBVPG6044   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_EC1118   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_FL100   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_FY1679   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_FostersB   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_FostersO   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_JAY291   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_JK9-3d   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_K11   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_Kyokai7   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_L1528   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_LalvinQA23   62   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   111
YGL253W_M22   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_PW5   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_RM11-1a   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_RedStar   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_SEY6210   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_SK1   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_T7   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_UC5   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_UWOPS05_217_3   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_VL3   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_Vin13   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_W303   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_X2180-1A   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_Y55   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_YJM339   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_YJM789   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_YPH499   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_YPS128   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_YPS163   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_YS9   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
YGL253W_ZTW1   201   IPIEVVALINDTTGTLVASYYTDPETKMGVIFGTGVNGAYYDVCSDIEKL   250
         

YGL253W_S288C   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_AWRI796   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_BC187   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_BY4741   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_BY4742   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_CBS7960   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_CEN.PK   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_CLIB215   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_CLIB324   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_D273-10B   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_DBVPG6044   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_EC1118   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_FL100   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_FY1679   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_FostersB   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_FostersO   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_JAY291   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_JK9-3d   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_K11   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_Kyokai7   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_L1528   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_LalvinQA23   112   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   161
YGL253W_M22   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_PW5   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_RM11-1a   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_RedStar   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_SEY6210   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_SK1   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_T7   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_UC5   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_UWOPS05_217_3   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_VL3   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_Vin13   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_W303   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_X2180-1A   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_Y55   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_YJM339   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_YJM789   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_YPH499   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_YPS128   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_YPS163   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_YS9   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
YGL253W_ZTW1   251   QGKLSDDIPPSAPMAINCEYGSFDNEHVVLPRTKYDITIDEESPRPGQQT   300
         

YGL253W_S288C   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_AWRI796   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_BC187   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_BY4741   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_BY4742   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_CBS7960   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_CEN.PK   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_CLIB215   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_CLIB324   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_D273-10B   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_DBVPG6044   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_EC1118   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_FL100   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_FY1679   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_FostersB   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMXTSYPARI   350
YGL253W_FostersO   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_JAY291   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_JK9-3d   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_K11   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_Kyokai7   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_L1528   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_LalvinQA23   162   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   211
YGL253W_M22   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_PW5   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_RM11-1a   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_RedStar   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_SEY6210   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_SK1   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_T7   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_UC5   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_UWOPS05_217_3   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_VL3   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_Vin13   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_W303   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_X2180-1A   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_Y55   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_YJM339   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_YJM789   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_YPH499   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_YPS128   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_YPS163   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_YS9   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
YGL253W_ZTW1   301   FEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPFVMDTSYPARI   350
         

YGL253W_S288C   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_AWRI796   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_BC187   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_BY4741   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_BY4742   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_CBS7960   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_CEN.PK   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_CLIB215   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_CLIB324   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_D273-10B   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_DBVPG6044   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_EC1118   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_FL100   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_FY1679   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_FostersB   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_FostersO   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_JAY291   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_JK9-3d   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_K11   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_Kyokai7   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_L1528   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_LalvinQA23   212   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   261
YGL253W_M22   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_PW5   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_RM11-1a   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_RedStar   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_SEY6210   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_SK1   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_T7   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_UC5   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_UWOPS05_217_3   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_VL3   351   EEDPFENLEDTDDLFQNEFCINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_Vin13   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_W303   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_X2180-1A   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_Y55   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_YJM339   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_YJM789   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_YPH499   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_YPS128   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_YPS163   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_YS9   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
YGL253W_ZTW1   351   EEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCGI   400
         

YGL253W_S288C   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_AWRI796   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_BC187   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_BY4741   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_BY4742   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_CBS7960   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_CEN.PK   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_CLIB215   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_CLIB324   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_D273-10B   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_DBVPG6044   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_EC1118   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_FL100   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_FY1679   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_FostersB   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_FostersO   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_JAY291   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_JK9-3d   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_K11   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_Kyokai7   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_L1528   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_LalvinQA23   262   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   311
YGL253W_M22   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_PW5   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_RM11-1a   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_RedStar   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_SEY6210   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_SK1   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_T7   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_UC5   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_UWOPS05_217_3   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_VL3   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_Vin13   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_W303   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_X2180-1A   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_Y55   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_YJM339   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_YJM789   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_YPH499   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_YPS128   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_YPS163   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_YS9   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
YGL253W_ZTW1   401   AAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYP   450
         

YGL253W_S288C   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_AWRI796   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_BC187   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_BY4741   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_BY4742   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_CBS7960   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_CEN.PK   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_CLIB215   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_CLIB324   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_D273-10B   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_DBVPG6044   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_EC1118   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_FL100   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_FY1679   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_FostersB   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_FostersO   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_JAY291   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_JK9-3d   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_K11   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_Kyokai7   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_L1528   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_LalvinQA23   312   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   347
YGL253W_M22   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_PW5   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_RM11-1a   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_RedStar   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_SEY6210   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_SK1   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_T7   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_UC5   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_UWOPS05_217_3   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_VL3   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_Vin13   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_W303   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_X2180-1A   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_Y55   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_YJM339   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_YJM789   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_YPH499   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_YPS128   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_YPS163   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_YS9   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
YGL253W_ZTW1   451   IKIVPAEDGSGAGAAVIAALAQKRIAEGKSVGIIGA   486
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YGL253W_S288C from SGD:

YGL253W_S288C [source=SGD]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_AWRI796 from AWRI:

YGL253W_AWRI796 [source=AWRI]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_BC187 from Stanford:

YGL253W_BC187 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_BY4741 from Stanford:

YGL253W_BY4741 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_BY4742 from Stanford:

YGL253W_BY4742 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_CBS7960 from WashU:

YGL253W_CBS7960 [source=WashU]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 2825  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMKT TQNPDELGEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_CEN.PK from Stanford:

YGL253W_CEN.PK [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_CLIB215 from WashU:

YGL253W_CLIB215 [source=WashU]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_CLIB324 from WashU:

YGL253W_CLIB324 [source=WashU]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_D273-10B from Stanford:

YGL253W_D273-10B [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_DBVPG6044 from Stanford:

YGL253W_DBVPG6044 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_EC1118 from Genoscope:

YGL253W_EC1118 [source=Genoscope]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3201  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDV PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_FL100 from Stanford:

YGL253W_FL100 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_FY1679 from Stanford:

YGL253W_FY1679 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_FostersB from AWRI:

YGL253W_FostersB [source=AWRI]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 4689  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVXVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP XSQNKINEGI LQRWTKGFDI PNIENHDVXP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMXTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_FostersO from AWRI:

YGL253W_FostersO [source=AWRI]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_JAY291 from Duke:

YGL253W_JAY291 [source=Duke]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_JK9-3d from Stanford:

YGL253W_JK9-3d [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_K11 from Stanford:

YGL253W_K11 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_Kyokai7 from NRIB:

YGL253W_Kyokai7 [source=NRIB]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_L1528 from Stanford:

YGL253W_L1528 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_LalvinQA23 from AWRI:

YGL253W_LalvinQA23 [source=AWRI]  Length: 348  Fri May 25 22:51:29 2018  Type: P  Check: 6356  ..

       1  MSNSHKVSLS QFHWVSPFLS QLLKTKSMKV SCKDGLKVLX FQTLKNHDVV

      51  PMLQKQITKR NIPIEVVALI NDTTGTLVAS YYTDPETKMG VIFGTGVNGA

     101  YYDVCSDIEK LQGKLSDDIP PSAPMAINCE YGSFDNEHVV LPRTKYDITI

     151  DEESPRPGQQ TFEKMSSGYY LGEILRLALM DMYKQGFIFK NQDLSKFDKP

     201  FVMDTSYPAR IEEDPFENLE DTDDLFQNEF GINTTVQERK LIRRLSELIG

     251  ARAARLSVCG IAAICQKRGY KTGHIAADGS VYNRYPGFKE KAANALKDIY

     301  GWTQTSLDDY PIKIVPAEDG SGAGAAVIAA LAQKRIAEGK SVGIIGA*


Protein Sequence for YGL253W_M22 from WashU:

YGL253W_M22 [source=WashU]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_PW5 from WashU:

YGL253W_PW5 [source=WashU]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_RM11-1a from Stanford:

YGL253W_RM11-1a [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_RedStar from Stanford:

YGL253W_RedStar [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_SEY6210 from Stanford:

YGL253W_SEY6210 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_SK1 from Stanford:

YGL253W_SK1 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_T7 from WashU:

YGL253W_T7 [source=WashU]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_UC5 from WashU:

YGL253W_UC5 [source=WashU]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_UWOPS05_217_3 from Stanford:

YGL253W_UWOPS05_217_3 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_VL3 from AWRI:

YGL253W_VL3 [source=AWRI]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 2972  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFC INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_Vin13 from AWRI:

YGL253W_Vin13 [source=AWRI]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3219  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDX PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_W303 from Stanford:

YGL253W_W303 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_X2180-1A from Stanford:

YGL253W_X2180-1A [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_Y55 from Stanford:

YGL253W_Y55 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_YJM339 from Stanford:

YGL253W_YJM339 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_YJM789 from Stanford:

YGL253W_YJM789 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_YPH499 from Stanford:

YGL253W_YPH499 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_YPS128 from Stanford:

YGL253W_YPS128 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_YPS163 from Stanford:

YGL253W_YPS163 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_YS9 from Stanford:

YGL253W_YS9 [source=Stanford]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*

Protein Sequence for YGL253W_ZTW1 from Zhejiang:

YGL253W_ZTW1 [source=Zhejiang]  Length: 487  Fri May 25 22:51:29 2018  Type: P  Check: 3084  ..

       1  MVHLGPKKPQ ARKGSMADVP KELMQQIENF EKIFTVPTET LQAVTKHFIS

      51  ELEKGLSKKG GNIPMIPGWV MDFPTGKESG DFLAIDLGGT NLRVVLVKLG

     101  GDRTFDTTQS KYRLPDAMRT TQNPDELWEF IADSLKAFID EQFPQGISEP

     151  IPLGFTFSFP ASQNKINEGI LQRWTKGFDI PNIENHDVVP MLQKQITKRN

     201  IPIEVVALIN DTTGTLVASY YTDPETKMGV IFGTGVNGAY YDVCSDIEKL

     251  QGKLSDDIPP SAPMAINCEY GSFDNEHVVL PRTKYDITID EESPRPGQQT

     301  FEKMSSGYYL GEILRLALMD MYKQGFIFKN QDLSKFDKPF VMDTSYPARI

     351  EEDPFENLED TDDLFQNEFG INTTVQERKL IRRLSELIGA RAARLSVCGI

     401  AAICQKRGYK TGHIAADGSV YNRYPGFKEK AANALKDIYG WTQTSLDDYP

     451  IKIVPAEDGS GAGAAVIAAL AQKRIAEGKS VGIIGA*