MIG1/YGL035C S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YGL035C_S288C   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_AWRI1631   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_AWRI796   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_BY4741   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_BY4742   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_CBS7960   
   --------------------------------------------------   
YGL035C_CEN.PK   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_CLIB215   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_CLIB324   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_D273-10B   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_EC1118   
   --------------------------------------------------   
YGL035C_EC9-8   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_FL100   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_FY1679   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_FostersB   1   -------------------------------------MLVLSVHRXFHRX   13
YGL035C_FostersO   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPIXHRXFHRX   50
YGL035C_JAY291   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_JK9-3d   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_K11   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_Kyokai7   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_LalvinQA23   
   --------------------------------------------------   
YGL035C_PW5   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_RM11-1a   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_RedStar   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_SEY6210   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_SK1   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_T7   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_T73   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_UC5   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_VL3   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_Vin13   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_W303   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_X2180-1A   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_Y55   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_YJM269   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_YJM339   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_YJM789   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_YPH499   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_YPS128   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_YS9   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
YGL035C_ZTW1   1   MQSPYPMTQVSNVDDGSLLKESKSKSKVAAKSEAPRPHACPICHRAFHRL   50
         

YGL035C_S288C   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_AWRI1631   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_AWRI796   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_BY4741   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_BY4742   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_CBS7960   
   --------------------------------------------------   
YGL035C_CEN.PK   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_CLIB215   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_CLIB324   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_D273-10B   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_EC1118   
   --------------------------------------------------   
YGL035C_EC9-8   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_FL100   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_FY1679   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_FostersB   14   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   63
YGL035C_FostersO   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_JAY291   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_JK9-3d   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_K11   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_Kyokai7   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_LalvinQA23   
   --------------------------------------------------   
YGL035C_PW5   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_RM11-1a   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_RedStar   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_SEY6210   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_SK1   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_T7   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_T73   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_UC5   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_VL3   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_Vin13   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_W303   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_X2180-1A   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_Y55   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_YJM269   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_YJM339   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_YJM789   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_YPH499   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_YPS128   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_YS9   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
YGL035C_ZTW1   51   EHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIHTNSHPRGKRG   100
         

YGL035C_S288C   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_AWRI1631   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_AWRI796   101   RKKKVVGSPINSASSSATSIPDSNTANFLPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_BY4741   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_BY4742   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_CBS7960   
   --------------------------------------------------   
YGL035C_CEN.PK   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_CLIB215   101   RKKKVVGSPINSASSSATSIPDSNTANFLPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_CLIB324   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_D273-10B   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_EC1118   
   --------------------------------------------------   
YGL035C_EC9-8   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_FL100   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_FY1679   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_FostersB   64   RKKKVVXSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   113
YGL035C_FostersO   101   RKKKVVGSPINSASSSATSIPDSNTANFLPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_JAY291   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_JK9-3d   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_K11   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_Kyokai7   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_LalvinQA23   
   --------------------------------------------------   
YGL035C_PW5   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_RM11-1a   101   RKKKVVGSPINSASSSATSIPDSNTANFLPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_RedStar   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_SEY6210   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_SK1   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_T7   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_T73   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_UC5   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_VL3   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHXSPLIPIAIAPKEN   150
YGL035C_Vin13   101   RKKKVVGSPINSASSSATSIPDSNTANFLPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_W303   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_X2180-1A   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_Y55   101   RKKKVVGSPINSASSSATSIPDSNTANFLPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_YJM269   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_YJM339   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_YJM789   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_YPH499   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_YPS128   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_YS9   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
YGL035C_ZTW1   101   RKKKVVGSPINSASSSATSIPDLNTANFSPPLPQQHLSPLIPIAIAPKEN   150
         

YGL035C_S288C   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_AWRI1631   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_AWRI796   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_BY4741   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_BY4742   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_CBS7960   1   -------------------------MVSSPKTMAKIPVSVKPPPSLALNN   25
YGL035C_CEN.PK   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_CLIB215   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_CLIB324   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_D273-10B   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_EC1118   
   --------------------------------------------------   
YGL035C_EC9-8   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_FL100   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_FY1679   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_FostersB   114   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   163
YGL035C_FostersO   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_JAY291   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSSALNN   200
YGL035C_JK9-3d   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_K11   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_Kyokai7   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_LalvinQA23   1   -------------------------MVSSPKTMAKIPVSVKPPPSLALNN   25
YGL035C_PW5   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_RM11-1a   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_RedStar   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_SEY6210   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_SK1   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_T7   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_T73   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_UC5   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_VL3   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_Vin13   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_W303   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_X2180-1A   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_Y55   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_YJM269   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_YJM339   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_YJM789   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_YPH499   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_YPS128   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_YS9   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
YGL035C_ZTW1   151   SSRSSTRKGRKTKFEIGESGGNDPYMVSSPKTMAKIPVSVKPPPSLALNN   200
         

YGL035C_S288C   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_AWRI1631   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_AWRI796   201   MNYQTSSASTALSSLSDSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_BY4741   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_BY4742   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_CBS7960   26   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   75
YGL035C_CEN.PK   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_CLIB215   201   MNYQTSSASTALSSLSDSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_CLIB324   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_D273-10B   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_EC1118   1   ---------------------------------MMTPIASSAPRTVFIDG   17
YGL035C_EC9-8   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_FL100   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_FY1679   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_FostersB   164   MNYQTSSASTALSSLSXSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   213
YGL035C_FostersO   201   MNYQTSSASTALSSLSDSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_JAY291   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_JK9-3d   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_K11   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_Kyokai7   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_LalvinQA23   26   MNYQTSSASTALSSLSXSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   75
YGL035C_PW5   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_RM11-1a   201   MNYQTSSASTALSSLSDSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_RedStar   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_SEY6210   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_SK1   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_T7   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_T73   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_UC5   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_VL3   201   MNYQTSSASTALSSLSXSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_Vin13   201   MNYQTSSASTALSSLSDSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_W303   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_X2180-1A   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_Y55   201   MNYQTSSASTALSSLSDSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_YJM269   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_YJM339   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_YJM789   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_YPH499   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_YPS128   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_YS9   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
YGL035C_ZTW1   201   MNYQTSSASTALSSLSNSHSGSRLKLNALSSLQMMTPIASSAPRTVFIDG   250
         

YGL035C_S288C   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_AWRI1631   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_AWRI796   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_BY4741   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_BY4742   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_CBS7960   76   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   125
YGL035C_CEN.PK   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_CLIB215   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_CLIB324   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_D273-10B   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_EC1118   18   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   67
YGL035C_EC9-8   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_FL100   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_FY1679   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_FostersB   214   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   263
YGL035C_FostersO   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_JAY291   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_JK9-3d   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_K11   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_Kyokai7   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_LalvinQA23   76   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   125
YGL035C_PW5   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_RM11-1a   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_RedStar   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_SEY6210   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_SK1   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_T7   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_T73   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_UC5   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_VL3   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_Vin13   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_W303   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_X2180-1A   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_Y55   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_YJM269   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_YJM339   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_YJM789   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_YPH499   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_YPS128   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_YS9   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
YGL035C_ZTW1   251   PEQKQLQQQQNSLSPRYSNTVILPRPRSLTDFQGLNNANPNNNGSLRAQT   300
         

YGL035C_S288C   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_AWRI1631   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_AWRI796   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_BY4741   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_BY4742   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_CBS7960   126   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   175
YGL035C_CEN.PK   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_CLIB215   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_CLIB324   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_D273-10B   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_EC1118   68   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   117
YGL035C_EC9-8   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_FL100   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_FY1679   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_FostersB   264   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   313
YGL035C_FostersO   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_JAY291   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_JK9-3d   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_K11   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_Kyokai7   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_LalvinQA23   126   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   175
YGL035C_PW5   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_RM11-1a   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_RedStar   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_SEY6210   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_SK1   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_T7   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_T73   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_UC5   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_VL3   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_Vin13   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_W303   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_X2180-1A   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_Y55   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_YJM269   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_YJM339   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_YJM789   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_YPH499   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_YPS128   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_YS9   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
YGL035C_ZTW1   301   QSSVQLKRPSSVLSLNDLLVGQRNTNESDSDFTTGGEDEEDGLKDPSNSS   350
         

YGL035C_S288C   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_AWRI1631   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNDLHSS   400
YGL035C_AWRI796   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_BY4741   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_BY4742   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_CBS7960   176   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   225
YGL035C_CEN.PK   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_CLIB215   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_CLIB324   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_D273-10B   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_EC1118   118   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   167
YGL035C_EC9-8   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_FL100   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_FY1679   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_FostersB   314   IDNLEQDYLQEQSRKKSKTSTPXTMLSRSTSGTNLHTLGYVMNQNHLHSS   363
YGL035C_FostersO   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_JAY291   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_JK9-3d   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_K11   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_Kyokai7   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_LalvinQA23   176   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   225
YGL035C_PW5   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_RM11-1a   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_RedStar   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_SEY6210   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_SK1   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_T7   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_T73   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_UC5   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_VL3   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNDLHSS   400
YGL035C_Vin13   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_W303   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_X2180-1A   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_Y55   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_YJM269   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_YJM339   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_YJM789   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_YPH499   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHFS   400
YGL035C_YPS128   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_YS9   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
YGL035C_ZTW1   351   IDNLEQDYLQEQSRKKSKTSTPTTMLSRSTSGTNLHTLGYVMNQNHLHSS   400
         

YGL035C_S288C   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_AWRI1631   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_AWRI796   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_BY4741   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_BY4742   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_CBS7960   226   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   275
YGL035C_CEN.PK   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_CLIB215   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_CLIB324   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_D273-10B   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_EC1118   168   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   217
YGL035C_EC9-8   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_FL100   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_FY1679   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_FostersB   364   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   413
YGL035C_FostersO   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_JAY291   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_JK9-3d   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_K11   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_Kyokai7   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_LalvinQA23   226   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   275
YGL035C_PW5   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_RM11-1a   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_RedStar   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_SEY6210   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_SK1   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_T7   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_T73   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_UC5   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_VL3   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_Vin13   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_W303   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_X2180-1A   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_Y55   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_YJM269   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_YJM339   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_YJM789   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_YPH499   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_YPS128   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_YS9   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
YGL035C_ZTW1   401   SSSPDFQKELNNRLLNVQQQQQEQHTLLQSQNTSNQSQNQNQNQMMASSS   450
         

YGL035C_S288C   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_AWRI1631   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_AWRI796   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_BY4741   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_BY4742   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_CBS7960   276   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   325
YGL035C_CEN.PK   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_CLIB215   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_CLIB324   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_D273-10B   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_EC1118   218   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   267
YGL035C_EC9-8   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_FL100   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_FY1679   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_FostersB   414   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   463
YGL035C_FostersO   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_JAY291   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_JK9-3d   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_K11   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_Kyokai7   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_LalvinQA23   276   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   325
YGL035C_PW5   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_RM11-1a   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_RedStar   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_SEY6210   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_SK1   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_T7   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_T73   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_UC5   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_VL3   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_Vin13   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_W303   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_X2180-1A   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_Y55   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_YJM269   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_YJM339   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_YJM789   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_YPH499   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_YPS128   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_YS9   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLPF   500
YGL035C_ZTW1   451   SLSTTPLLLSPRVNMINTAISTQQTPISQSDSQVQELETLPPIRSLPLTF   500
         

YGL035C_S288C   501   PHMD   504
YGL035C_AWRI1631   501   PHMD   504
YGL035C_AWRI796   501   PHMD   504
YGL035C_BY4741   501   PHMD   504
YGL035C_BY4742   501   PHMD   504
YGL035C_CBS7960   326   PHMD   329
YGL035C_CEN.PK   501   PHMD   504
YGL035C_CLIB215   501   PHMD   504
YGL035C_CLIB324   501   PHMD   504
YGL035C_D273-10B   501   PHMD   504
YGL035C_EC1118   268   PHMD   271
YGL035C_EC9-8   501   PHMD   504
YGL035C_FL100   501   PHMD   504
YGL035C_FY1679   501   PHMD   504
YGL035C_FostersB   464   PHMD   467
YGL035C_FostersO   501   PHMD   504
YGL035C_JAY291   501   PHMD   504
YGL035C_JK9-3d   501   PHMD   504
YGL035C_K11   501   PHMD   504
YGL035C_Kyokai7   501   PHMD   504
YGL035C_LalvinQA23   326   PHMD   329
YGL035C_PW5   501   PHMD   504
YGL035C_RM11-1a   501   PHMD   504
YGL035C_RedStar   501   PHMD   504
YGL035C_SEY6210   501   PHMD   504
YGL035C_SK1   501   PHMD   504
YGL035C_T7   501   PHMD   504
YGL035C_T73   501   PHMD   504
YGL035C_UC5   501   PHMD   504
YGL035C_VL3   501   PHMD   504
YGL035C_Vin13   501   PHMD   504
YGL035C_W303   501   PHMD   504
YGL035C_X2180-1A   501   PHMD   504
YGL035C_Y55   501   PHMD   504
YGL035C_YJM269   501   PHMD   504
YGL035C_YJM339   501   PHMD   504
YGL035C_YJM789   501   PHMD   504
YGL035C_YPH499   501   PHMD   504
YGL035C_YPS128   501   PHMD   504
YGL035C_YS9   501   PHMD   504
YGL035C_ZTW1   501   PHMD   504
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YGL035C_S288C from SGD:

YGL035C_S288C [source=SGD]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_AWRI1631 from AWRI:

YGL035C_AWRI1631 [source=AWRI]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8074  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNDLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_AWRI796 from AWRI:

YGL035C_AWRI796 [source=AWRI]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7788  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDSNTANFLP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSDSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_BY4741 from Stanford:

YGL035C_BY4741 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_BY4742 from Stanford:

YGL035C_BY4742 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_CBS7960 from WashU:

YGL035C_CBS7960 [source=WashU]  Length: 330  Sun Feb 25 03:30:26 2018  Type: P  Check: 4971  ..

       1  MVSSPKTMAK IPVSVKPPPS LALNNMNYQT SSASTALSSL SNSHSGSRLK

      51  LNALSSLQMM TPIASSAPRT VFIDGPEQKQ LQQQQNSLSP RYSNTVILPR

     101  PRSLTDFQGL NNANPNNNGS LRAQTQSSVQ LKRPSSVLSL NDLLVGQRNT

     151  NESDSDFTTG GEDEEDGLKD PSNSSIDNLE QDYLQEQSRK KSKTSTPTTM

     201  LSRSTSGTNL HTLGYVMNQN HLHSSSSSPD FQKELNNRLL NVQQQQQEQH

     251  TLLQSQNTSN QSQNQNQNQM MASSSSLSTT PLLLSPRVNM INTAISTQQT

     301  PISQSDSQVQ ELETLPPIRS LPLPFPHMD*

Protein Sequence for YGL035C_CEN.PK from Stanford:

YGL035C_CEN.PK [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_CLIB215 from WashU:

YGL035C_CLIB215 [source=WashU]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7788  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDSNTANFLP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSDSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_CLIB324 from WashU:

YGL035C_CLIB324 [source=WashU]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_D273-10B from Stanford:

YGL035C_D273-10B [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_EC1118 from Genoscope:

YGL035C_EC1118 [source=Genoscope]  Length: 272  Sun Feb 25 03:30:26 2018  Type: P  Check: 2781  ..

       1  MMTPIASSAP RTVFIDGPEQ KQLQQQQNSL SPRYSNTVIL PRPRSLTDFQ

      51  GLNNANPNNN GSLRAQTQSS VQLKRPSSVL SLNDLLVGQR NTNESDSDFT

     101  TGGEDEEDGL KDPSNSSIDN LEQDYLQEQS RKKSKTSTPT TMLSRSTSGT

     151  NLHTLGYVMN QNHLHSSSSS PDFQKELNNR LLNVQQQQQE QHTLLQSQNT

     201  SNQSQNQNQN QMMASSSSLS TTPLLLSPRV NMINTAISTQ QTPISQSDSQ

     251  VQELETLPPI RSLPLPFPHM D*

Protein Sequence for YGL035C_EC9-8 from ASinica:

YGL035C_EC9-8 [source=ASinica]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_FL100 from Stanford:

YGL035C_FL100 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_FY1679 from Stanford:

YGL035C_FY1679 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_FostersB from AWRI:

YGL035C_FostersB [source=AWRI]  Length: 468  Sun Feb 25 03:30:26 2018  Type: P  Check: 6738  ..

       1  MLVLSVHRXF HRXEHQTRHM RIHTGEKPHA CDFPGCVKRF SRSDELTRHR

      51  RIHTNSHPRG KRGRKKKVVX SPINSASSSA TSIPDLNTAN FSPPLPQQHL

     101  SPLIPIAIAP KENSSRSSTR KGRKTKFEIG ESGGNDPYMV SSPKTMAKIP

     151  VSVKPPPSLA LNNMNYQTSS ASTALSSLSX SHSGSRLKLN ALSSLQMMTP

     201  IASSAPRTVF IDGPEQKQLQ QQQNSLSPRY SNTVILPRPR SLTDFQGLNN

     251  ANPNNNGSLR AQTQSSVQLK RPSSVLSLND LLVGQRNTNE SDSDFTTGGE

     301  DEEDGLKDPS NSSIDNLEQD YLQEQSRKKS KTSTPXTMLS RSTSGTNLHT

     351  LGYVMNQNHL HSSSSSPDFQ KELNNRLLNV QQQQQEQHTL LQSQNTSNQS

     401  QNQNQNQMMA SSSSLSTTPL LLSPRVNMIN TAISTQQTPI SQSDSQVQEL

     451  ETLPPIRSLP LPFPHMD*

Protein Sequence for YGL035C_FostersO from AWRI:

YGL035C_FostersO [source=AWRI]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 349  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PIXHRXFHRX

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDSNTANFLP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSDSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_JAY291 from Duke:

YGL035C_JAY291 [source=Duke]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7724  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSSALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_JK9-3d from Stanford:

YGL035C_JK9-3d [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_K11 from Stanford:

YGL035C_K11 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_Kyokai7 from NRIB:

YGL035C_Kyokai7 [source=NRIB]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_LalvinQA23 from AWRI:

YGL035C_LalvinQA23 [source=AWRI]  Length: 330  Sun Feb 25 03:30:26 2018  Type: P  Check: 5391  ..

       1  MVSSPKTMAK IPVSVKPPPS LALNNMNYQT SSASTALSSL SXSHSGSRLK

      51  LNALSSLQMM TPIASSAPRT VFIDGPEQKQ LQQQQNSLSP RYSNTVILPR

     101  PRSLTDFQGL NNANPNNNGS LRAQTQSSVQ LKRPSSVLSL NDLLVGQRNT

     151  NESDSDFTTG GEDEEDGLKD PSNSSIDNLE QDYLQEQSRK KSKTSTPTTM

     201  LSRSTSGTNL HTLGYVMNQN HLHSSSSSPD FQKELNNRLL NVQQQQQEQH

     251  TLLQSQNTSN QSQNQNQNQM MASSSSLSTT PLLLSPRVNM INTAISTQQT

     301  PISQSDSQVQ ELETLPPIRS LPLPFPHMD*

Protein Sequence for YGL035C_PW5 from WashU:

YGL035C_PW5 [source=WashU]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_RM11-1a from Stanford:

YGL035C_RM11-1a [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7788  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDSNTANFLP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSDSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_RedStar from Stanford:

YGL035C_RedStar [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_SEY6210 from Stanford:

YGL035C_SEY6210 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_SK1 from Stanford:

YGL035C_SK1 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_T7 from WashU:

YGL035C_T7 [source=WashU]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_T73 from WashU:

YGL035C_T73 [source=WashU]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_UC5 from WashU:

YGL035C_UC5 [source=WashU]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_VL3 from AWRI:

YGL035C_VL3 [source=AWRI]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8810  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHXSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSXSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNDLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_Vin13 from AWRI:

YGL035C_Vin13 [source=AWRI]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7788  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDSNTANFLP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSDSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_W303 from Stanford:

YGL035C_W303 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_X2180-1A from Stanford:

YGL035C_X2180-1A [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_Y55 from Stanford:

YGL035C_Y55 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7788  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDSNTANFLP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSDSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_YJM269 from WashU:

YGL035C_YJM269 [source=WashU]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_YJM339 from Stanford:

YGL035C_YJM339 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_YJM789 from Stanford:

YGL035C_YJM789 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_YPH499 from Stanford:

YGL035C_YPH499 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 7549  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHFS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_YPS128 from Stanford:

YGL035C_YPS128 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_YS9 from Stanford:

YGL035C_YS9 [source=Stanford]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8290  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLPF

     501  PHMD*

Protein Sequence for YGL035C_ZTW1 from Zhejiang:

YGL035C_ZTW1 [source=Zhejiang]  Length: 505  Sun Feb 25 03:30:26 2018  Type: P  Check: 8462  ..

       1  MQSPYPMTQV SNVDDGSLLK ESKSKSKVAA KSEAPRPHAC PICHRAFHRL

      51  EHQTRHMRIH TGEKPHACDF PGCVKRFSRS DELTRHRRIH TNSHPRGKRG

     101  RKKKVVGSPI NSASSSATSI PDLNTANFSP PLPQQHLSPL IPIAIAPKEN

     151  SSRSSTRKGR KTKFEIGESG GNDPYMVSSP KTMAKIPVSV KPPPSLALNN

     201  MNYQTSSAST ALSSLSNSHS GSRLKLNALS SLQMMTPIAS SAPRTVFIDG

     251  PEQKQLQQQQ NSLSPRYSNT VILPRPRSLT DFQGLNNANP NNNGSLRAQT

     301  QSSVQLKRPS SVLSLNDLLV GQRNTNESDS DFTTGGEDEE DGLKDPSNSS

     351  IDNLEQDYLQ EQSRKKSKTS TPTTMLSRST SGTNLHTLGY VMNQNHLHSS

     401  SSSPDFQKEL NNRLLNVQQQ QQEQHTLLQS QNTSNQSQNQ NQNQMMASSS

     451  SLSTTPLLLS PRVNMINTAI STQQTPISQS DSQVQELETL PPIRSLPLTF

     501  PHMD*