PMC1/YGL006W S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YGL006W_S288C   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_AWRI796   1   -------------MKITNHRIREMRT---EPTIISNYQKSQLSDLHNPKS   34
YGL006W_BC187   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_BY4741   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_BY4742   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_CEN.PK   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_CLIB215   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_D273-10B   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_DBVPG6044   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_EC1118   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_EC9-8   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_FL100   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_FY1679   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_FostersB   1   -----------------------------------------MTRINYSKX   9
YGL006W_FostersO   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_JAY291   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_JK9-3d   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_Kyokai7   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_L1528   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_LalvinQA23   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_PW5   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_RM11-1a   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_RedStar   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_SEY6210   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_SK1   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_T7   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_UC5   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_UWOPS05_217_3   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_W303   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_X2180-1A   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_Y55   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_YJM269   1   MSRQDENSALLANNENNKPSYTGNGNGAYRSYDNFKLSKSQLSDLHNPKS   50
YGL006W_YJM339   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_YJM789   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_YPH499   1   MSRQDENSALLANNENNKPSYTGNEN---GVYDNFKLSKSQLSDLHNPKS   47
YGL006W_YPS128   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_YPS163   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_YS9   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
YGL006W_ZTW1   1   MSRQDENSALLANNENNKPSYTGNEN---GAYDNFKLSKSQLSDLHNPKS   47
         

YGL006W_S288C   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_AWRI796   35   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   84
YGL006W_BC187   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_BY4741   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_BY4742   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_CEN.PK   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_CLIB215   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_D273-10B   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_DBVPG6044   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_EC1118   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_EC9-8   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_FL100   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_FY1679   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_FostersB   10   VNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLRDQPMEKFNIEKVV   59
YGL006W_FostersO   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_JAY291   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_JK9-3d   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_Kyokai7   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_L1528   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_LalvinQA23   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_PW5   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_RM11-1a   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_RedStar   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_SEY6210   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_SK1   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_T7   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_UC5   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_UWOPS05_217_3   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   48   XRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_W303   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_X2180-1A   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_Y55   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_YJM269   51   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   100
YGL006W_YJM339   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_YJM789   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_YPH499   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_YPS128   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_YPS163   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_YS9   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
YGL006W_ZTW1   48   IRSFVRLFGYESNSLFKYLKTDKNAGISLPEISNYRKTNRYKNYGDNSLP   97
         

YGL006W_S288C   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_AWRI796   85   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   134
YGL006W_BC187   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_BY4741   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_BY4742   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_CEN.PK   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_CLIB215   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_D273-10B   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_DBVPG6044   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_EC1118   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_EC9-8   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_FL100   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_FY1679   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_FostersB   60   QTIPFESSRKWAGLVVKYKEGKNKKPFYRFFIKGAAEIVSKNCSYK----   105
YGL006W_FostersO   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_JAY291   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_JK9-3d   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_Kyokai7   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_L1528   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_LalvinQA23   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_PW5   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_RM11-1a   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_RedStar   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_SEY6210   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_SK1   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_T7   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_UC5   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_UWOPS05_217_3   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_W303   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_X2180-1A   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_Y55   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_YJM269   101   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   150
YGL006W_YJM339   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_YJM789   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_YPH499   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_YPS128   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_YPS163   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_YS9   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
YGL006W_ZTW1   98   ERIPKSFLQLVWAAFNDKTMQLLTVAAVVSFVLGLYELWMQPPQYDPEGN   147
         

YGL006W_S288C   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_BY4741   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_BY4742   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_CEN.PK   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_DBVPG6044   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_EC1118   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLKKKKENRKIIVI   197
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_FY1679   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_Kyokai7   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQMELQFAKLNKKKENRKIIVI   197
YGL006W_L1528   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_LalvinQA23   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_SEY6210   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_SK1   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_T7   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_UC5   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQMELQFAKLNKKKENRKIIVI   197
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_X2180-1A   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   151   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   200
YGL006W_YJM339   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_YJM789   
   --------------------------------------------------   
YGL006W_YPH499   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_YPS128   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_YPS163   
   --------------------------------------------------   
YGL006W_YS9   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
YGL006W_ZTW1   148   KIKQVDWIEGVAIMIAVFVVVLVSAANDYQKELQFAKLNKKKENRKIIVI   197
         

YGL006W_S288C   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_BY4741   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_BY4742   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_CEN.PK   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_DBVPG6044   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_EC1118   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_FY1679   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_Kyokai7   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_L1528   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_LalvinQA23   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_SEY6210   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_SK1   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_T7   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_UC5   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_X2180-1A   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   201   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   250
YGL006W_YJM339   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_YJM789   
   --------------------------------------------------   
YGL006W_YPH499   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_YPS128   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_YPS163   
   --------------------------------------------------   
YGL006W_YS9   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
YGL006W_ZTW1   198   RNDQEILISIHHVLVGDVISLQTGDVVPADCVMISGKCEADESSITGESN   247
         

YGL006W_S288C   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_BY4741   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_BY4742   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_CEN.PK   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_DBVPG6044   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_EC1118   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_FY1679   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_Kyokai7   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_L1528   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_LalvinQA23   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_SEY6210   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_SK1   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_T7   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_UC5   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_X2180-1A   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   251   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   300
YGL006W_YJM339   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_YJM789   
   --------------------------------------------------   
YGL006W_YPH499   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_YPS128   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_YPS163   
   --------------------------------------------------   
YGL006W_YS9   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
YGL006W_ZTW1   248   TIQKFPVDNSLRDFKKFNSIDSHNHSKPLDIGDVNEDGNKIADCMLISGS   297
         

YGL006W_S288C   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_BY4741   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_BY4742   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_CEN.PK   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_DBVPG6044   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_EC1118   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_FY1679   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_Kyokai7   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_L1528   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_LalvinQA23   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_SEY6210   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_SK1   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_T7   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_UC5   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_X2180-1A   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   301   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   350
YGL006W_YJM339   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_YJM789   
   --------------------------------------------------   
YGL006W_YPH499   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_YPS128   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_YPS163   
   --------------------------------------------------   
YGL006W_YS9   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
YGL006W_ZTW1   298   RILSGLGRGVITSVGINSVYGQTMTSLNAEPESTPLQLHLSQLADNISVY   347
         

YGL006W_S288C   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_BY4741   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_BY4742   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_CEN.PK   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_DBVPG6044   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_EC1118   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_FY1679   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_Kyokai7   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_L1528   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_LalvinQA23   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_SEY6210   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_SK1   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_T7   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_UC5   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_X2180-1A   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   351   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   400
YGL006W_YJM339   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_YJM789   
   --------------------------------------------------   
YGL006W_YPH499   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_YPS128   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_YPS163   
   --------------------------------------------------   
YGL006W_YS9   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
YGL006W_ZTW1   348   GCVSAIILFLVLFTRYLFYIIPEDGRFHDLDPAQKGSKFMNIFITSITVI   397
         

YGL006W_S288C   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_BY4741   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_BY4742   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_CEN.PK   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_DBVPG6044   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_EC1118   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_FY1679   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_Kyokai7   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_L1528   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_LalvinQA23   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVXVLRSCETMGSATAVCSDKT   447
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_SEY6210   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_SK1   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_T7   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_UC5   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_X2180-1A   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   401   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   450
YGL006W_YJM339   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_YJM789   
   --------------------------------------------------   
YGL006W_YPH499   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_YPS128   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_YPS163   
   --------------------------------------------------   
YGL006W_YS9   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
YGL006W_ZTW1   398   VVAVPEGLPLAVTLALAFATTRMTKDGNLVRVLRSCETMGSATAVCSDKT   447
         

YGL006W_S288C   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_BY4741   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_BY4742   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_CEN.PK   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   448   GTLTENVMTVVRGFLGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_DBVPG6044   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_EC1118   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   448   GTLTENVMTVVRGFLGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_FY1679   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_Kyokai7   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_L1528   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_LalvinQA23   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_SEY6210   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_SK1   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_T7   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_UC5   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_X2180-1A   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   451   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   500
YGL006W_YJM339   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_YJM789   
   --------------------------------------------------   
YGL006W_YPH499   448   GTLTENVMTVVRGFPGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_YPS128   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_YPS163   
   --------------------------------------------------   
YGL006W_YS9   448   GTLTENVMTVVRGFLGNSKFDDNKSLPVSEQRKLNSKKVFEENCSSSLRN   497
YGL006W_ZTW1   448   GTLTENVMTVVRGFLGNSKFDDSKSLPVSEQRKLNSKKVFEENCSSSLRN   497
         

YGL006W_S288C   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_BY4741   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_BY4742   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_CEN.PK   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_DBVPG6044   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_EC1118   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_FY1679   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_Kyokai7   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_L1528   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_LalvinQA23   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_SEY6210   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_SK1   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_T7   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_UC5   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_X2180-1A   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   501   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   550
YGL006W_YJM339   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_YJM789   
   --------------------------------------------------   
YGL006W_YPH499   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_YPS128   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_YPS163   
   --------------------------------------------------   
YGL006W_YS9   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
YGL006W_ZTW1   498   DLLANIVLNSTAFENRDYKKNDKNTNGSKNMSKNLSFLDKCKSRLSFFKK   547
         

YGL006W_S288C   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_AWRI796   
   --------------------------------------------------   
YGL006W_BC187   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_BY4741   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_BY4742   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_CEN.PK   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_CLIB215   
   --------------------------------------------------   
YGL006W_D273-10B   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_DBVPG6044   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_EC1118   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_EC9-8   
   --------------------------------------------------   
YGL006W_FL100   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_FY1679   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_FostersB   
   --------------------------------------------------   
YGL006W_FostersO   
   --------------------------------------------------   
YGL006W_JAY291   
   --------------------------------------------------   
YGL006W_JK9-3d   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_Kyokai7   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_L1528   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_LalvinQA23   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETAXLSLARLSLGLQPGELQYLR   597
YGL006W_PW5   
   --------------------------------------------------   
YGL006W_RM11-1a   
   --------------------------------------------------   
YGL006W_RedStar   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_SEY6210   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_SK1   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_T7   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_UC5   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_UWOPS05_217_3   
   --------------------------------------------------   
YGL006W_VL3   
   --------------------------------------------------   
YGL006W_Vin13   
   --------------------------------------------------   
YGL006W_W303   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_X2180-1A   548   GNREDDEDQLFKNVNKGRQEPFIGSKTETALLSLARLSLGLQPGELQYLR   597
YGL006W_Y55   
   --------------------------------------------------   
YGL006W_YJM269   551   GNREDDEDQLFKNVNKGRQEPFIGSKT