YFR036W-A S. cerevisiae Strain Sequence Alignment Help




ClustalWSequence Alignment

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical

YFR036W-A_S288C   1   --MTIVHFVGSLFFFFFFSYIFFYNDHGLYTWGCNFAMESPSPTSSPSLP   48
YFR036W-A_AWRI1631   1   -------------------------------------MESPAPTSSPSLP   13
YFR036W-A_AWRI796   1   MTIVHFVGSLXFFFFFFSLYIXFYNDHGLYTWGCNFAMESPSPTSSPSLP   50
YFR036W-A_CBS7960   1   -------------------------------------MESPSPTSSPSLP   13
YFR036W-A_CLIB215   1   -MTIVHFVG-SLFFFFFFSYIFFYNDHGLYTWGCNFAMESPSPTSSPSLP   48
YFR036W-A_EC1118   1   -------------------------------------MESPSPTSSPSLP   13
YFR036W-A_EC9-8   1   ----MTIVHFVGSSFFFFSYIFFYNDHGLYTWGCNFAMESPSPTSSPSLP   46
YFR036W-A_FostersO   1   -------------------------------------MESPSPTSSPSLP   13
YFR036W-A_Kyokai7   1   -------------------------------------MESPSPTSSPSLP   13
YFR036W-A_T7   1   -------------------------------------MESPSPTSSPSLP   13
YFR036W-A_UC5   1   -------------------------------------MESPSPTSSPSLP   13
YFR036W-A_VL3   1   -MTIVHFVGSSFFFFFFSLXYIFYNDHGLYTWGCNFAMESPXPTSSPSLP   49
YFR036W-A_Vin13   1   -------------------------------------MESPXPTSSPSLP   13
YFR036W-A_YJM269   1   -------------------------------------MESPSPTSSPSLP   13
YFR036W-A_YJM789   1   -MTIVHFVGSLFFFFFFFSYIFFYNDHGLYTWGCNFAMESPSPTSSPSLP   49
YFR036W-A_ZTW1   1   -------------------------------------MESPSPTSSPSLP   13
         

YFR036W-A_S288C   49   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   98
YFR036W-A_AWRI1631   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
YFR036W-A_AWRI796   51   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   100
YFR036W-A_CBS7960   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
YFR036W-A_CLIB215   49   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   98
YFR036W-A_EC1118   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
YFR036W-A_EC9-8   47   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   96
YFR036W-A_FostersO   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
YFR036W-A_Kyokai7   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
YFR036W-A_T7   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
YFR036W-A_UC5   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFSSSSDLFR   63
YFR036W-A_VL3   50   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   99
YFR036W-A_Vin13   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
YFR036W-A_YJM269   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
YFR036W-A_YJM789   50   TRFTPCPVAVLPSSSPPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   99
YFR036W-A_ZTW1   14   TRFTPCPVAVLPSSSSPSWSFSTSCMPESTCSEISTSFFDTFNSSSDLFR   63
         

YFR036W-A_S288C   99   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   148
YFR036W-A_AWRI1631   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_AWRI796   101   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   150
YFR036W-A_CBS7960   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_CLIB215   99   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   148
YFR036W-A_EC1118   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_EC9-8   97   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   146
YFR036W-A_FostersO   64   SRICLLSDNRSFXIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_Kyokai7   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_T7   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_UC5   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_VL3   100   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   149
YFR036W-A_Vin13   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_YJM269   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
YFR036W-A_YJM789   100   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   149
YFR036W-A_ZTW1   64   SRICLLSDNRSFSIFSDSFTYFSFSISSCVSRSHSFVNLLSNFSMVSLTN   113
         

YFR036W-A_S288C   149   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   198
YFR036W-A_AWRI1631   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_AWRI796   151   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   200
YFR036W-A_CBS7960   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_CLIB215   149   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   198
YFR036W-A_EC1118   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_EC9-8   147   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   196
YFR036W-A_FostersO   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_Kyokai7   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_T7   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_UC5   114   SWIIAWLSSTYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_VL3   150   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   199
YFR036W-A_Vin13   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_YJM269   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
YFR036W-A_YJM789   150   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   199
YFR036W-A_ZTW1   114   SWIIAWLSSMYFSEISLDLSETLPNLSSPCSSVWTASFTHSINFEPDTLP   163
         

YFR036W-A_S288C   199   SRLSPPLPFSVEPTTSRM   216
YFR036W-A_AWRI1631   164   SRLSPPLPFSVEPTTSWM   181
YFR036W-A_AWRI796   201   SRLSPPLPFSVEPTTSWM   218
YFR036W-A_CBS7960   164   SRLSPPLPFSVEPTTSWM   181
YFR036W-A_CLIB215   199   SRLSPPLPFSVEPTTSWM   216
YFR036W-A_EC1118   164   SRLSPPLPFSVEPTTSRM   181
YFR036W-A_EC9-8   197   SRLSPPLPFSVEPTTSWM   214
YFR036W-A_FostersO   164   SRLSPPLPFSVEPTTSXM   181
YFR036W-A_Kyokai7   164   SRLSPPLPFSVEPTTSWM   181
YFR036W-A_T7   164   SRLSPPLPFSVEPTTSWM   181
YFR036W-A_UC5   164   SRLSPPLPFSVEPTTSWM   181
YFR036W-A_VL3   200   SRLSPPLPFSVEPTTSWM   217
YFR036W-A_Vin13   164   SRLSPPLPFSVEPTTSWM   181
YFR036W-A_YJM269   164   SRLSPPLPFSVEPTTSWM   181
YFR036W-A_YJM789   200   SRLSPPLPFSVEPTTSWM   217
YFR036W-A_ZTW1   164   SRLSPPLPFSVEPTTSWM   181
         

Color Keys:
100% identical
90-99% identical
75-89% identical
< 75% identical


DOWNLOAD all sequences in alignment, in FASTA format. GCG format sequences are displayed below.

Protein Sequence for YFR036W-A_S288C from SGD:

YFR036W-A_S288C [source=SGD]  Length: 217  Sat Sep 23 05:06:17 2017  Type: P  Check: 8273  ..

       1  MTIVHFVGSL FFFFFFSYIF FYNDHGLYTW GCNFAMESPS PTSSPSLPTR

      51  FTPCPVAVLP SSSSPSWSFS TSCMPESTCS EISTSFFDTF NSSSDLFRSR

     101  ICLLSDNRSF SIFSDSFTYF SFSISSCVSR SHSFVNLLSN FSMVSLTNSW

     151  IIAWLSSMYF SEISLDLSET LPNLSSPCSS VWTASFTHSI NFEPDTLPSR

     201  LSPPLPFSVE PTTSRM*

Protein Sequence for YFR036W-A_AWRI1631 from AWRI:

YFR036W-A_AWRI1631 [source=AWRI]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3437  ..

       1  MESPAPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSW M*

Protein Sequence for YFR036W-A_AWRI796 from AWRI:

YFR036W-A_AWRI796 [source=AWRI]  Length: 219  Sat Sep 23 05:06:17 2017  Type: P  Check: 6566  ..

       1  MTIVHFVGSL XFFFFFFSLY IXFYNDHGLY TWGCNFAMES PSPTSSPSLP

      51  TRFTPCPVAV LPSSSSPSWS FSTSCMPEST CSEISTSFFD TFNSSSDLFR

     101  SRICLLSDNR SFSIFSDSFT YFSFSISSCV SRSHSFVNLL SNFSMVSLTN

     151  SWIIAWLSSM YFSEISLDLS ETLPNLSSPC SSVWTASFTH SINFEPDTLP

     201  SRLSPPLPFS VEPTTSWM*

Protein Sequence for YFR036W-A_CBS7960 from WashU:

YFR036W-A_CBS7960 [source=WashU]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3527  ..

       1  MESPSPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSW M*

Protein Sequence for YFR036W-A_CLIB215 from WashU:

YFR036W-A_CLIB215 [source=WashU]  Length: 217  Sat Sep 23 05:06:17 2017  Type: P  Check: 8493  ..

       1  MTIVHFVGSL FFFFFFSYIF FYNDHGLYTW GCNFAMESPS PTSSPSLPTR

      51  FTPCPVAVLP SSSSPSWSFS TSCMPESTCS EISTSFFDTF NSSSDLFRSR

     101  ICLLSDNRSF SIFSDSFTYF SFSISSCVSR SHSFVNLLSN FSMVSLTNSW

     151  IIAWLSSMYF SEISLDLSET LPNLSSPCSS VWTASFTHSI NFEPDTLPSR

     201  LSPPLPFSVE PTTSWM*

Protein Sequence for YFR036W-A_EC1118 from Genoscope:

YFR036W-A_EC1118 [source=Genoscope]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3482  ..

       1  MESPSPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSR M*

Protein Sequence for YFR036W-A_EC9-8 from ASinica:

YFR036W-A_EC9-8 [source=ASinica]  Length: 215  Sat Sep 23 05:06:17 2017  Type: P  Check: 1864  ..

       1  MTIVHFVGSS FFFFSYIFFY NDHGLYTWGC NFAMESPSPT SSPSLPTRFT

      51  PCPVAVLPSS SSPSWSFSTS CMPESTCSEI STSFFDTFNS SSDLFRSRIC

     101  LLSDNRSFSI FSDSFTYFSF SISSCVSRSH SFVNLLSNFS MVSLTNSWII

     151  AWLSSMYFSE ISLDLSETLP NLSSPCSSVW TASFTHSINF EPDTLPSRLS

     201  PPLPFSVEPT TSWM*

Protein Sequence for YFR036W-A_FostersO from AWRI:

YFR036W-A_FostersO [source=AWRI]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3631  ..

       1  MESPSPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFXIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSX M*

Protein Sequence for YFR036W-A_Kyokai7 from NRIB:

YFR036W-A_Kyokai7 [source=NRIB]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3527  ..

       1  MESPSPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSW M*

Protein Sequence for YFR036W-A_T7 from WashU:

YFR036W-A_T7 [source=WashU]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3527  ..

       1  MESPSPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSW M*

Protein Sequence for YFR036W-A_UC5 from WashU:

YFR036W-A_UC5 [source=WashU]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3870  ..

       1  MESPSPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFSSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSTYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSW M*

Protein Sequence for YFR036W-A_VL3 from AWRI:

YFR036W-A_VL3 [source=AWRI]  Length: 218  Sat Sep 23 05:06:17 2017  Type: P  Check: 3337  ..

       1  MTIVHFVGSS FFFFFFSLXY IFYNDHGLYT WGCNFAMESP XPTSSPSLPT

      51  RFTPCPVAVL PSSSSPSWSF STSCMPESTC SEISTSFFDT FNSSSDLFRS

     101  RICLLSDNRS FSIFSDSFTY FSFSISSCVS RSHSFVNLLS NFSMVSLTNS

     151  WIIAWLSSMY FSEISLDLSE TLPNLSSPCS SVWTASFTHS INFEPDTLPS

     201  RLSPPLPFSV EPTTSWM*

Protein Sequence for YFR036W-A_Vin13 from AWRI:

YFR036W-A_Vin13 [source=AWRI]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3552  ..

       1  MESPXPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSW M*

Protein Sequence for YFR036W-A_YJM269 from WashU:

YFR036W-A_YJM269 [source=WashU]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3527  ..

       1  MESPSPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSW M*

Protein Sequence for YFR036W-A_YJM789 from Stanford:

YFR036W-A_YJM789 [source=Stanford]  Length: 218  Sat Sep 23 05:06:17 2017  Type: P  Check: 2579  ..

       1  MTIVHFVGSL FFFFFFFSYI FFYNDHGLYT WGCNFAMESP SPTSSPSLPT

      51  RFTPCPVAVL PSSSPPSWSF STSCMPESTC SEISTSFFDT FNSSSDLFRS

     101  RICLLSDNRS FSIFSDSFTY FSFSISSCVS RSHSFVNLLS NFSMVSLTNS

     151  WIIAWLSSMY FSEISLDLSE TLPNLSSPCS SVWTASFTHS INFEPDTLPS

     201  RLSPPLPFSV EPTTSWM*

Protein Sequence for YFR036W-A_ZTW1 from Zhejiang:

YFR036W-A_ZTW1 [source=Zhejiang]  Length: 182  Sat Sep 23 05:06:17 2017  Type: P  Check: 3527  ..

       1  MESPSPTSSP SLPTRFTPCP VAVLPSSSSP SWSFSTSCMP ESTCSEISTS

      51  FFDTFNSSSD LFRSRICLLS DNRSFSIFSD SFTYFSFSIS SCVSRSHSFV

     101  NLLSNFSMVS LTNSWIIAWL SSMYFSEISL DLSETLPNLS SPCSSVWTAS

     151  FTHSINFEPD TLPSRLSPPL PFSVEPTTSW M*